DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m5-HLH and HES5

DIOPT Version :9

Sequence 1:NP_524511.1 Gene:E(spl)m5-HLH / 43158 FlyBaseID:FBgn0002631 Length:178 Species:Drosophila melanogaster
Sequence 2:XP_005244808.1 Gene:HES5 / 388585 HGNCID:19764 Length:198 Species:Homo sapiens


Alignment Length:226 Identity:44/226 - (19%)
Similarity:77/226 - (34%) Gaps:86/226 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAPQSNNSTTFVSKTQHYLKVKKPLLERQRRARMNKCLDTLKTLV-AEFQGDDAILRMDKAEMLE 64
            ::|:..|            :::||::|:.||.|:|..::.||.|: .||.......:::||::||
Human    11 LSPKEKN------------RLRKPVVEKMRRDRINSSIEQLKLLLEQEFARHQPNSKLEKADILE 63

  Fly    65 AALVFMR----------KQVVKQQAPVSPLPM----------------------DSFKNGYMNAV 97
            .|:.:::          :.....:||..|.|.                      ..:..||...:
Human    64 MAVSYLKHSKGERARAPRAPSSHRAPAPPRPAARSPPPRLPAAFVAAAGPKSLHQDYSEGYSWCL 128

  Fly    98 SEISRVMACTPAMSVDVGKTVMTHLGVEFQRMLQADQVQTSVTTSTPRPLSPASSGYHSDNEDSQ 162
            .|  .|...|...:.|....::.|    |||                .|.:||:..    .|...
Human   129 QE--AVQFLTLHAASDTQMKLLYH----FQR----------------PPAAPAAPA----KEPKA 167

  Fly   163 SAASPKPVEET---------------MWRPW 178
            ..|:|.|....               :||||
Human   168 PGAAPPPALSAKATAAAAAAHQPACGLWRPW 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m5-HLHNP_524511.1 HLH 20..72 CDD:238036 17/62 (27%)
ORANGE 87..131 CDD:128787 10/43 (23%)
HES5XP_005244808.1 HLH 14..71 CDD:238036 18/68 (26%)
Hairy_orange 118..153 CDD:295407 8/40 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140942
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1378299at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10733
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.880

Return to query results.
Submit another query.