Sequence 1: | NP_524511.1 | Gene: | E(spl)m5-HLH / 43158 | FlyBaseID: | FBgn0002631 | Length: | 178 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005244808.1 | Gene: | HES5 / 388585 | HGNCID: | 19764 | Length: | 198 | Species: | Homo sapiens |
Alignment Length: | 226 | Identity: | 44/226 - (19%) |
---|---|---|---|
Similarity: | 77/226 - (34%) | Gaps: | 86/226 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MAPQSNNSTTFVSKTQHYLKVKKPLLERQRRARMNKCLDTLKTLV-AEFQGDDAILRMDKAEMLE 64
Fly 65 AALVFMR----------KQVVKQQAPVSPLPM----------------------DSFKNGYMNAV 97
Fly 98 SEISRVMACTPAMSVDVGKTVMTHLGVEFQRMLQADQVQTSVTTSTPRPLSPASSGYHSDNEDSQ 162
Fly 163 SAASPKPVEET---------------MWRPW 178 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
E(spl)m5-HLH | NP_524511.1 | HLH | 20..72 | CDD:238036 | 17/62 (27%) |
ORANGE | 87..131 | CDD:128787 | 10/43 (23%) | ||
HES5 | XP_005244808.1 | HLH | 14..71 | CDD:238036 | 18/68 (26%) |
Hairy_orange | 118..153 | CDD:295407 | 8/40 (20%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165140942 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1378299at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R10733 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.880 |