DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m5-HLH and hes6

DIOPT Version :9

Sequence 1:NP_524511.1 Gene:E(spl)m5-HLH / 43158 FlyBaseID:FBgn0002631 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_919381.2 Gene:hes6 / 373116 ZFINID:ZDB-GENE-030828-5 Length:226 Species:Danio rerio


Alignment Length:237 Identity:62/237 - (26%)
Similarity:98/237 - (41%) Gaps:70/237 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAPQSNNSTTFVSKTQHY----LKVKKPLLERQRRARMNKCLDTLKTLVAEFQGDDAILRMDKAE 61
            |||.|.::|   ....:|    .|.:|||:|::||||:|:.|..|:.|:|:   .||.::|:.||
Zfish     1 MAPASRSNT---HDEDNYGIKDRKTRKPLVEKKRRARINESLQELRLLLAD---PDAQVKMENAE 59

  Fly    62 MLEAALVFMRKQV-------VKQQAPVSPLPMDSFKNGYMNAVSEISRVMACTPAMSVDVGKTVM 119
            :||..:    |:|       .|:...|:....:.|..||:..:.|:...::..|.:...:...::
Zfish    60 VLEMTV----KRVESILQNKAKEADSVNREANERFAAGYIQCMHEVHTFVSSCPGIDATIAADLL 120

  Fly   120 THL--------GVEFQRMLQADQVQ---------------------TSVTTSTPRPLSPASSGYH 155
            .||        ...||.:| :|.:.                     |||.......||||.|...
Zfish   121 NHLLECMPLNDEERFQDIL-SDLISDSNNSGTWPGEAAYATLSPGGTSVANGGSSALSPAPSTTS 184

  Fly   156 SDN-----ED--------SQSAASPKPVEETM------WRPW 178
            ||:     :|        |..|....||..|:      ||||
Zfish   185 SDDICSDLDDTDTEHSRISVDAGDQAPVVPTLYTNKSIWRPW 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m5-HLHNP_524511.1 HLH 20..72 CDD:238036 21/51 (41%)
ORANGE 87..131 CDD:128787 9/51 (18%)
hes6NP_919381.2 HLH 18..75 CDD:238036 23/63 (37%)
Hairy_orange 90..128 CDD:284859 7/37 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573603
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5073
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.