DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m5-HLH and dpn

DIOPT Version :9

Sequence 1:NP_524511.1 Gene:E(spl)m5-HLH / 43158 FlyBaseID:FBgn0002631 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_476923.1 Gene:dpn / 35800 FlyBaseID:FBgn0010109 Length:435 Species:Drosophila melanogaster


Alignment Length:164 Identity:41/164 - (25%)
Similarity:79/164 - (48%) Gaps:19/164 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KVKKPLLERQRRARMNKCLDTLKTLVAEFQGDDAI--LRMDKAEMLEAALVFMRKQVVKQQAPVS 82
            |..||::|::||||:|.||:.||:|:.|....|..  .:::||::||..:..: :.|.:||..::
  Fly    42 KTNKPIMEKRRRARINHCLNELKSLILEAMKKDPARHTKLEKADILEMTVKHL-QSVQRQQLNMA 105

  Fly    83 ----PLPMDSFKNGYMNAVSEISRVMACTPAMSVDVGKTVMTHLG------------VEFQRMLQ 131
                |..:..||.|::....|::|.::....:...|.:.:..||.            ..|....:
  Fly   106 IQSDPSVVQKFKTGFVECAEEVNRYVSQMDGIDTGVRQRLSAHLNQCANSLEQIGSMSNFSNGYR 170

  Fly   132 ADQVQTSVTTSTPRPLSPASSGYHSDNEDSQSAA 165
            ......:..|:.|.||.|:.....::|..::|:|
  Fly   171 GGLFPATAVTAAPTPLFPSLPQDLNNNSRTESSA 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m5-HLHNP_524511.1 HLH 20..72 CDD:238036 20/53 (38%)
ORANGE 87..131 CDD:128787 9/55 (16%)
dpnNP_476923.1 HLH 39..101 CDD:238036 21/59 (36%)
ORANGE 114..158 CDD:128787 8/43 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438347
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.