DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m5-HLH and Hey

DIOPT Version :9

Sequence 1:NP_524511.1 Gene:E(spl)m5-HLH / 43158 FlyBaseID:FBgn0002631 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_523657.1 Gene:Hey / 35764 FlyBaseID:FBgn0027788 Length:425 Species:Drosophila melanogaster


Alignment Length:178 Identity:43/178 - (24%)
Similarity:85/178 - (47%) Gaps:21/178 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAPQSNNSTTFVSKTQHYLKVKKPLLERQRRARMNKCLDTLKTLVAEFQGDDAILRMDKAEMLEA 65
            ::|....|...:|:     |.::.::|::||.|:|..|..||.||..........:::|||:|:.
  Fly    88 ISPSEPGSCQLMSR-----KKRRGVIEKKRRDRINSSLTELKRLVPSAYEKQGSAKLEKAEILQL 147

  Fly    66 ALVFMRKQVVKQQAPVSPLP----MDSFKNGYMNAVSEISRVMACTPAMSVD--VGKTVMTHLGV 124
            .:..::....|....:|..|    ||....|:....:|::|.:.....|.:.  :...:|:||  
  Fly   148 TVEHLKSLQSKTLDSLSYDPQRVAMDYHIIGFRECAAEVARYLVTIEGMDIQDPLRLRLMSHL-- 210

  Fly   125 EFQRMLQADQVQTSVTTSTP---RPLSPASSGYHSDNEDS--QSAASP 167
              |..:|..:: ::.:.::|   .|.:|:||||..:...:  ||.|:|
  Fly   211 --QYFVQQREL-SAKSCASPGGWSPAAPSSSGYQPNCAAAPYQSYAAP 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m5-HLHNP_524511.1 HLH 20..72 CDD:238036 15/51 (29%)
ORANGE 87..131 CDD:128787 9/45 (20%)
HeyNP_523657.1 HLH 100..156 CDD:238036 16/60 (27%)
ORANGE 172..218 CDD:128787 11/49 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.