DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m5-HLH and Sidpn

DIOPT Version :9

Sequence 1:NP_524511.1 Gene:E(spl)m5-HLH / 43158 FlyBaseID:FBgn0002631 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_523599.1 Gene:Sidpn / 35168 FlyBaseID:FBgn0032741 Length:507 Species:Drosophila melanogaster


Alignment Length:185 Identity:45/185 - (24%)
Similarity:83/185 - (44%) Gaps:28/185 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 NSTTFVSKTQHYLK-VKKPLLERQRRARMNKCLDTLKTLVAEF---------QGDDAILRMDKAE 61
            :||..|:.:|...| ..|||:|::||||:|:.|..||.|:.|.         :|.....:::||:
  Fly    38 SSTQNVTSSQDISKRTNKPLMEKRRRARINQSLAILKALILESTKTQNAKNGEGQAKHTKLEKAD 102

  Fly    62 MLEAAL-VFMRKQVVKQQAPVSPLPMDSFKNGYMNAVSEISRVMACTPAMSVDVGKTVMTHLGVE 125
            :||..: .|.|.:.:....      ::.::.||.:...|::|.:| ||..........:...|.:
  Fly   103 ILELTVRHFQRHRNLDDPT------VNKYRAGYTDCAREVARYLA-TPEPPPMGTMPTLAEPGSK 160

  Fly   126 FQRMLQADQ------VQTSVTTSTPRPLSPASSGYHSDNEDSQSAASPKPVEETM 174
            .:.:...||      |:....::.....||:||.....|...:|    :|.|.::
  Fly   161 ARLLRHLDQCIAEIDVEICPHSTAAFAESPSSSSCFDLNHGKKS----QPEEHSL 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m5-HLHNP_524511.1 HLH 20..72 CDD:238036 21/62 (34%)
ORANGE 87..131 CDD:128787 8/43 (19%)
SidpnNP_523599.1 HLH 48..117 CDD:238036 22/68 (32%)
Hairy_orange 125..172 CDD:284859 10/47 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438348
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.