DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m5-HLH and bhlhe40

DIOPT Version :9

Sequence 1:NP_524511.1 Gene:E(spl)m5-HLH / 43158 FlyBaseID:FBgn0002631 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_997844.2 Gene:bhlhe40 / 324413 ZFINID:ZDB-GENE-030131-3133 Length:403 Species:Danio rerio


Alignment Length:173 Identity:38/173 - (21%)
Similarity:69/173 - (39%) Gaps:33/173 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KVKKPLLERQRRARMNKCLDTLKTLVAEFQGDDAILRMDKAEMLEAALVFMRK------------ 72
            |:...|:|::||.|:|:|:..||.|:.|......:..::||.:||..|..::.            
Zfish    51 KLPHRLIEKKRRDRINECIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHVKALNNLLEQQQQKI 115

  Fly    73 -------QVVKQQAPVSPLPMDSFKNGYMNAVSEISRVMACTPAMSVDVGKTVMTHLGVEFQRML 130
                   |:.:|....|....:.|::|:.....|:.:.:|....|.......::.||        
Zfish   116 ISLQNGLQIGEQGNGPSENSEEMFRSGFHLCAKEVLQFLANQETMRDLTTAHIIEHL-------- 172

  Fly   131 QADQVQTSVTTSTPRPL--SPASSGYHSDNEDSQSAASPKPVE 171
              .:|.:.:..|.|.|.  .|||..  .::.:..|...||..|
Zfish   173 --QKVASELIQSPPSPRLDEPASKA--QESREKPSGLQPKAAE 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m5-HLHNP_524511.1 HLH 20..72 CDD:238036 17/51 (33%)
ORANGE 87..131 CDD:128787 7/43 (16%)
bhlhe40NP_997844.2 HLH 51..109 CDD:238036 17/57 (30%)
Hairy_orange 139..177 CDD:284859 8/47 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573797
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.