DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m5-HLH and her8a

DIOPT Version :9

Sequence 1:NP_524511.1 Gene:E(spl)m5-HLH / 43158 FlyBaseID:FBgn0002631 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_955918.3 Gene:her8a / 323656 ZFINID:ZDB-GENE-030131-2376 Length:221 Species:Danio rerio


Alignment Length:219 Identity:56/219 - (25%)
Similarity:91/219 - (41%) Gaps:50/219 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PQSNNSTTFVSKTQHYLKVKKPLLERQRRARMNKCLDTLKTLVAEFQGDDAILRMDKAEMLEAAL 67
            |:.|    |.:|.:.  |::|||:|::||.|:|..|:.||.::.:....|. .:::||::||..:
Zfish    10 PEKN----FNAKEER--KLRKPLIEKKRRERINSSLEQLKGIMVDAYNLDQ-SKLEKADVLEITV 67

  Fly    68 VFMRKQVVKQQAPVSPLPMDSFK------NGYMNAVSEISRVMACTPAMSVDVGKTVMTHLGVEF 126
            ..|...........|..|...|:      :||:..:.|:..::...|.|...:|..::.||....
Zfish    68 QHMENLQRGHGQGGSNSPGTGFESRQRYSSGYIQCMHEVHNLLLSCPGMDKTLGARLLNHLLKSL 132

  Fly   127 QRMLQADQVQTSVTTSTPRPLSPA----------------------SSGYHS---DNEDSQSAAS 166
            ..:.......:|..||:|.||||.                      ||..||   ..|.|...:|
Zfish   133 PHISTEPSGTSSAGTSSPLPLSPTQSPINLPSSLQPHALLLSPSPPSSPTHSLVRPREQSSPPSS 197

  Fly   167 PKP------------VEETMWRPW 178
            |.|            |:.:|||||
Zfish   198 PSPQSPASLPPFFPGVDPSMWRPW 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m5-HLHNP_524511.1 HLH 20..72 CDD:238036 18/51 (35%)
ORANGE 87..131 CDD:128787 9/49 (18%)
her8aNP_955918.3 HLH 17..75 CDD:238036 19/60 (32%)
Hairy_orange 95..133 CDD:284859 8/37 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573647
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5073
OMA 1 1.010 - - QHG47782
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.