DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m5-HLH and Heyl

DIOPT Version :9

Sequence 1:NP_524511.1 Gene:E(spl)m5-HLH / 43158 FlyBaseID:FBgn0002631 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001101447.1 Gene:Heyl / 313575 RGDID:1305022 Length:326 Species:Rattus norvegicus


Alignment Length:132 Identity:32/132 - (24%)
Similarity:62/132 - (46%) Gaps:18/132 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KVKKPLLERQRRARMNKCLDTLKTLVA---EFQGDDAILRMDKAEMLEAALVFMRKQVVKQQA-- 79
            |.::.::|::||.|:|..|..|:.||.   |.||..   :::|||:|:..:..::.......|  
  Rat    45 KKRRGIIEKRRRDRINSSLSELRRLVPTAFEKQGSS---KLEKAEVLQMTVDHLKMLHASGGAGF 106

  Fly    80 -PVSPLPMDSFKNGYMNAVSEISRVMACT--PAMSVD-VGKTVMTHLGVEFQRMLQADQVQTSVT 140
             ....|.:|....|:...::|:.|.:...  |:...| |...:::||.      ..|.:::.|.|
  Rat   107 FDARALAVDFRSIGFRECLTEVVRYLGVLEGPSSHADPVRIRLLSHLN------SYAAEMEPSPT 165

  Fly   141 TS 142
            |:
  Rat   166 TT 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m5-HLHNP_524511.1 HLH 20..72 CDD:238036 17/54 (31%)
ORANGE 87..131 CDD:128787 9/46 (20%)
HeylNP_001101447.1 bHLH-O_HEYL 36..109 CDD:381453 18/66 (27%)
ORANGE 115..162 CDD:128787 10/52 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334589
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.