DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m5-HLH and her2

DIOPT Version :9

Sequence 1:NP_524511.1 Gene:E(spl)m5-HLH / 43158 FlyBaseID:FBgn0002631 Length:178 Species:Drosophila melanogaster
Sequence 2:XP_005155978.1 Gene:her2 / 30300 ZFINID:ZDB-GENE-980526-274 Length:133 Species:Danio rerio


Alignment Length:183 Identity:43/183 - (23%)
Similarity:72/183 - (39%) Gaps:55/183 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAPQSNNSTTFVSKTQH----YLKVKKPLLERQRRARMNKCLDTLKTLV-AEFQGDDAILRMDKA 60
            |||.       |.|..|    ..|::||::|:.||.|:|||::.||.|: .|.:......:::||
Zfish     1 MAPT-------VCKATHTGKERTKLRKPVVEKMRRDRINKCIEQLKILLKTEIKASQPCSKLEKA 58

  Fly    61 EMLEAALVFMRKQVVKQQAPVSPLPMDSFKNGYMNAVSEISRVMACTPAMSVDVGKTVMTHLGVE 125
            ::||.|:::::..........|.....|:.:||...:.|.:|.::              .|    
Zfish    59 DILEMAVIYLKNTADAHARSYSEAHAQSYADGYSRCIEETARFLS--------------AH---- 105

  Fly   126 FQRMLQADQVQTSVTTSTPRPLSPASSGYHSDNEDSQSAASPKPVEETMWRPW 178
                   .|.|.                 ||...||....| :..:..:||||
Zfish   106 -------KQTQK-----------------HSKPVDSCQITS-EIAKHGLWRPW 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m5-HLHNP_524511.1 HLH 20..72 CDD:238036 19/52 (37%)
ORANGE 87..131 CDD:128787 6/43 (14%)
her2XP_005155978.1 HLH 13..70 CDD:238036 19/56 (34%)
ORANGE 85..133 CDD:128787 15/90 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573678
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1378299at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.