Sequence 1: | NP_524511.1 | Gene: | E(spl)m5-HLH / 43158 | FlyBaseID: | FBgn0002631 | Length: | 178 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_571154.2 | Gene: | her6 / 30288 | ZFINID: | ZDB-GENE-980526-144 | Length: | 270 | Species: | Danio rerio |
Alignment Length: | 256 | Identity: | 52/256 - (20%) |
---|---|---|---|
Similarity: | 103/256 - (40%) | Gaps: | 83/256 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 PQSNNSTTFVSKT-QHYLKVKKPLLERQRRARMNKCLDTLKTLVAEFQGDDAI--LRMDKAEMLE 64
Fly 65 AALVFMRKQVVKQQAPVS------PLPMDSFKNGYMNAVSEISRVMACTPAMSVDVGKTVMTHL- 122
Fly 123 ---------GVEFQRMLQA-------DQVQTSVTTSTPR----PLS------------------- 148
Fly 149 -------PASSG-------------------YHSDNEDSQ-----SAASPKPVEETMWRPW 178 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
E(spl)m5-HLH | NP_524511.1 | HLH | 20..72 | CDD:238036 | 19/53 (36%) |
ORANGE | 87..131 | CDD:128787 | 7/53 (13%) | ||
her6 | NP_571154.2 | HLH | 32..95 | CDD:238036 | 21/65 (32%) |
Hairy_orange | 110..148 | CDD:284859 | 6/37 (16%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170573733 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4304 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000785 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR10985 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
6 | 5.840 |