DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m5-HLH and her1

DIOPT Version :9

Sequence 1:NP_524511.1 Gene:E(spl)m5-HLH / 43158 FlyBaseID:FBgn0002631 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_571153.1 Gene:her1 / 30287 ZFINID:ZDB-GENE-980526-125 Length:328 Species:Danio rerio


Alignment Length:192 Identity:37/192 - (19%)
Similarity:73/192 - (38%) Gaps:57/192 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KVKKPLLERQRRARMNKCLDTLKTLVAEFQGDDAIL--RMDKAEMLEAALVFMRKQVV------- 75
            ::.||::|::||.|:|:.|:.|:||:.:...|..:.  :::|||:||.|:.::|.:..       
Zfish    14 RILKPVIEKKRRDRINQRLEELRTLLLDNTLDSRLQNPKLEKAEILELAVEYIRTKTATARDQGD 78

  Fly    76 ----------------KQQAPVSPLPMD----------SFKNGYMNAVSEISRVMACTPAMSVDV 114
                            :.|.|.:.:|..          .:|.|:...:|..:..:.|......|.
Zfish    79 SSKDTHDPKPPPLLSRRPQMPCASIPESIQTHNSPSNPIYKAGFKECISRSASFIDCVEPSQRDS 143

  Fly   115 GKTVMTHLGVEFQRMLQADQVQTSVT----------------------TSTPRPLSPASSGY 154
            ....:.|....:...|...:|.::.|                      .:.|.|.|.|:|.|
Zfish   144 FVQGLCHHLDSYSSALPHGRVSSNPTHHPWIPNPELSCRTDVQSIGHMRANPEPYSYANSLY 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m5-HLHNP_524511.1 HLH 20..72 CDD:238036 18/53 (34%)
ORANGE 87..131 CDD:128787 6/53 (11%)
her1NP_571153.1 HLH 10..67 CDD:238036 18/52 (35%)
Hairy_orange 118..157 CDD:284859 6/38 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573807
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.