DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m5-HLH and her5

DIOPT Version :9

Sequence 1:NP_524511.1 Gene:E(spl)m5-HLH / 43158 FlyBaseID:FBgn0002631 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_571152.1 Gene:her5 / 30285 ZFINID:ZDB-GENE-990415-90 Length:205 Species:Danio rerio


Alignment Length:212 Identity:50/212 - (23%)
Similarity:87/212 - (41%) Gaps:67/212 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KVKKPLLERQRRARMNKCLDTLKTLVAEFQGDDAIL--RMDKAEMLEAALVFMRKQVVKQQAPV- 81
            :|.|||:|::||.|:|:.|:||:.|:.|...::.:.  :::|||:||:.:.|:|.:...:..|. 
Zfish     8 RVPKPLMEKRRRDRINQSLETLRMLLLENTNNEKLKNPKVEKAEILESVVHFLRAEQASETDPFQ 72

  Fly    82 -----------------SPLPMDSFKNGYMNAVSEISRVMACTPAMSVDVGKTVMTHLGVEFQRM 129
                             ||....|:.:|....:..:|..:         .||:  ...|.|.::.
Zfish    73 ITRVKRARTEESDEDVESPCKRQSYHDGMRTCLLRVSNFI---------TGKS--HEFGQELEKA 126

  Fly   130 LQ------ADQVQTSVTTSTPRPLSPASSGYHSDNED-------SQS-----------------A 164
            .:      :.|||   ..|||..:.|....|...::.       |.|                 .
Zfish   127 CENIHKSHSRQVQ---LLSTPSLIEPQVHLYEDPSQQHLAHVQLSNSCTPSGCSKLAQRTVPAMT 188

  Fly   165 ASPK-PVE--ETMWRPW 178
            :||| ||.  :.:||||
Zfish   189 SSPKQPVMLCDPVWRPW 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m5-HLHNP_524511.1 HLH 20..72 CDD:238036 20/53 (38%)
ORANGE 87..131 CDD:128787 7/43 (16%)
her5NP_571152.1 HLH 4..67 CDD:238036 21/58 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573709
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.