Sequence 1: | NP_524511.1 | Gene: | E(spl)m5-HLH / 43158 | FlyBaseID: | FBgn0002631 | Length: | 178 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_571152.1 | Gene: | her5 / 30285 | ZFINID: | ZDB-GENE-990415-90 | Length: | 205 | Species: | Danio rerio |
Alignment Length: | 212 | Identity: | 50/212 - (23%) |
---|---|---|---|
Similarity: | 87/212 - (41%) | Gaps: | 67/212 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 20 KVKKPLLERQRRARMNKCLDTLKTLVAEFQGDDAIL--RMDKAEMLEAALVFMRKQVVKQQAPV- 81
Fly 82 -----------------SPLPMDSFKNGYMNAVSEISRVMACTPAMSVDVGKTVMTHLGVEFQRM 129
Fly 130 LQ------ADQVQTSVTTSTPRPLSPASSGYHSDNED-------SQS-----------------A 164
Fly 165 ASPK-PVE--ETMWRPW 178 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
E(spl)m5-HLH | NP_524511.1 | HLH | 20..72 | CDD:238036 | 20/53 (38%) |
ORANGE | 87..131 | CDD:128787 | 7/43 (16%) | ||
her5 | NP_571152.1 | HLH | 4..67 | CDD:238036 | 21/58 (36%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170573709 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4304 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.740 |