DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m5-HLH and Hes2

DIOPT Version :10

Sequence 1:NP_524511.1 Gene:E(spl)m5-HLH / 43158 FlyBaseID:FBgn0002631 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_062109.1 Gene:Hes2 / 29567 RGDID:62082 Length:157 Species:Rattus norvegicus


Alignment Length:165 Identity:50/165 - (30%)
Similarity:84/165 - (50%) Gaps:28/165 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KVKKPLLERQRRARMNKCLDTLKTLVAEFQGDDA--ILRMDKAEMLEAALVFMRKQVVKQQAPVS 82
            |..|||||::||||:|:.|..||.||....|.:.  ..:::||::||..:.|:|:|.....:..:
  Rat    15 KSLKPLLEKRRRARINESLSQLKGLVLPLLGAETSRYSKLEKADILEMTVRFLREQPASVCSTEA 79

  Fly    83 PLPMDSFKNGYMNAVSEISRVM-ACT---PAMSVDVGKTVMTHLGVEFQRMLQADQVQTSVTTST 143
            |..:||:..||...::.::||: ||:   ||:|.               |:|  :.::....:..
  Rat    80 PGSLDSYLEGYRACLARLARVLPACSVLEPAVSA---------------RLL--EHLRQRTVSGG 127

  Fly   144 PRPLSPASSGYHSDNEDSQSAASPKPVEETMWRPW 178
            |..|:|||:     :..:.|...|.|....:||||
  Rat   128 PPSLTPASA-----SAPAPSPPVPPPSSLGLWRPW 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m5-HLHNP_524511.1 bHLH-O_ESM5_like 20..78 CDD:381486 24/59 (41%)
ORANGE 87..131 CDD:128787 12/47 (26%)
Hes2NP_062109.1 bHLH_SF 10..73 CDD:469605 24/57 (42%)
ORANGE 84..128 CDD:128787 13/60 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..157 10/37 (27%)
WRPW motif 154..157 2/2 (100%)

Return to query results.
Submit another query.