DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m5-HLH and HEYL

DIOPT Version :10

Sequence 1:NP_524511.1 Gene:E(spl)m5-HLH / 43158 FlyBaseID:FBgn0002631 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_055386.2 Gene:HEYL / 26508 HGNCID:4882 Length:328 Species:Homo sapiens


Alignment Length:177 Identity:43/177 - (24%)
Similarity:71/177 - (40%) Gaps:62/177 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KVKKPLLERQRRARMNKCLDTLKTLVA---EFQGDDAILRMDKAEMLEAALVFMRKQVVKQQAPV 81
            |..:.::|::||.|:|..|..|:.||.   |.||..   :::|||:|:                 
Human    45 KKHRGIIEKRRRDRINSSLSELRRLVPTAFEKQGSS---KLEKAEVLQ----------------- 89

  Fly    82 SPLPMDSFK-------NGYMNAVSEISRVMACTPAMSVD---VG-----KTVMTHLGVEFQRMLQ 131
              :.:|..|       .|:.:|           .|::||   :|     ..|:.:|||......:
Human    90 --MTVDHLKMLHATGGTGFFDA-----------RALAVDFRSIGFRECLTEVIRYLGVLEGPSSR 141

  Fly   132 ADQVQTSVTTSTPRPLSPASSGYHSDNEDSQSAASPKPVEETMWRPW 178
            ||.|:.       |.||..:| |.::.|.|.:...  |:....| ||
Human   142 ADPVRI-------RLLSHLNS-YAAEMEPSPTPTG--PLAFPAW-PW 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m5-HLHNP_524511.1 bHLH-O_ESM5_like 20..78 CDD:381486 17/60 (28%)
ORANGE 87..131 CDD:128787 12/58 (21%)
HEYLNP_055386.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..57 3/11 (27%)
bHLH-O_HEYL 36..109 CDD:381453 20/85 (24%)
Transcriptional repression and interaction with NCOR1 and SIN3A. /evidence=ECO:0000250 42..111 21/98 (21%)
ORANGE 115..162 CDD:128787 14/54 (26%)
PHA03247 <136..311 CDD:223021 14/53 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 239..308
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.