DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m5-HLH and HEY1

DIOPT Version :10

Sequence 1:NP_524511.1 Gene:E(spl)m5-HLH / 43158 FlyBaseID:FBgn0002631 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001035798.1 Gene:HEY1 / 23462 HGNCID:4880 Length:308 Species:Homo sapiens


Alignment Length:93 Identity:23/93 - (24%)
Similarity:47/93 - (50%) Gaps:7/93 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KVKKPLLERQRRARMNKCLDTLKTLV-AEFQG---DDAILRMDKAEMLEAA---LVFMRKQVVKQ 77
            |.::.::|::||.|:|..|..|:.|| :.|:.   :....:::|||:|:..   |..:.....|.
Human    51 KRRRGIIEKRRRDRINNSLSELRRLVPSAFEKQVMEQGSAKLEKAEILQMTVDHLKMLHTAGGKG 115

  Fly    78 QAPVSPLPMDSFKNGYMNAVSEISRVMA 105
            ......|.||....|:...::|::|.::
Human   116 YFDAHALAMDYRSLGFRECLAEVARYLS 143

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
E(spl)m5-HLHNP_524511.1 bHLH-O_ESM5_like 20..78 CDD:381486 17/64 (27%)
ORANGE 87..131 CDD:128787 4/19 (21%)