DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m5-HLH and lin-22

DIOPT Version :9

Sequence 1:NP_524511.1 Gene:E(spl)m5-HLH / 43158 FlyBaseID:FBgn0002631 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_500281.1 Gene:lin-22 / 177082 WormBaseID:WBGene00003008 Length:173 Species:Caenorhabditis elegans


Alignment Length:145 Identity:36/145 - (24%)
Similarity:69/145 - (47%) Gaps:28/145 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KVK-KPLLERQRRARMNKCLDTLKTLVAEFQGDDAI--LRMDKAEMLEAALVFMRKQVVKQQAPV 81
            |:| |||:|::||||:||.|..||.::.:.:..::|  .:.:||::||.|:.::::....|...:
 Worm    22 KIKNKPLMEKKRRARINKSLSQLKQILIQDEHKNSIQHSKWEKADILEMAVEYLQQLRSAQPCSL 86

  Fly    82 SPL----------------------PMDSFKNGYMN---AVSEISRVMACTPAMSVDVGKTVMTH 121
            ||.                      |:.||.|..|.   |..:::::...|...:...|..:...
 Worm    87 SPSTSSISTPPTPKEEIRNIKVPLNPIASFLNPMMQQYVAYQQLAQLSMYTQLFNNPAGVPLRAD 151

  Fly   122 LGVEFQRMLQADQVQ 136
            .||..|....|::::
 Worm   152 AGVTAQSPELAEKLK 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m5-HLHNP_524511.1 HLH 20..72 CDD:238036 21/54 (39%)
ORANGE 87..131 CDD:128787 10/46 (22%)
lin-22NP_500281.1 bHLH_O_HES 29..82 CDD:381416 16/52 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.