DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m5-HLH and Hey1

DIOPT Version :9

Sequence 1:NP_524511.1 Gene:E(spl)m5-HLH / 43158 FlyBaseID:FBgn0002631 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_034553.2 Gene:Hey1 / 15213 MGIID:1341800 Length:299 Species:Mus musculus


Alignment Length:92 Identity:25/92 - (27%)
Similarity:46/92 - (50%) Gaps:9/92 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KVKKPLLERQRRARMNKCLDTLKTLVA---EFQGDDAILRMDKAEMLEAA---LVFMRKQVVKQQ 78
            |.::.::|::||.|:|..|..|:.||.   |.||.   .:::|||:|:..   |..:.....|..
Mouse    51 KRRRGIIEKRRRDRINNSLSELRRLVPSAFEKQGS---AKLEKAEILQMTVDHLKMLHTAGGKGY 112

  Fly    79 APVSPLPMDSFKNGYMNAVSEISRVMA 105
            .....|.||....|:...::|::|.::
Mouse   113 FDAHALAMDYRSLGFRECLAEVARYLS 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m5-HLHNP_524511.1 HLH 20..72 CDD:238036 18/57 (32%)
ORANGE 87..131 CDD:128787 4/19 (21%)
Hey1NP_034553.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..53 1/1 (100%)
Transcriptional repression and interaction with NCOR1 and SIN3A. /evidence=ECO:0000250 48..117 19/68 (28%)
HLH 50..107 CDD:238036 18/58 (31%)
ORANGE 120..166 CDD:128787 5/20 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..234
YRPW motif 289..292
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830841
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.