DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m5-HLH and Hes2

DIOPT Version :9

Sequence 1:NP_524511.1 Gene:E(spl)m5-HLH / 43158 FlyBaseID:FBgn0002631 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001288734.1 Gene:Hes2 / 15206 MGIID:1098624 Length:157 Species:Mus musculus


Alignment Length:158 Identity:46/158 - (29%)
Similarity:78/158 - (49%) Gaps:20/158 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 KPLLERQRRARMNKCLDTLKTLVAEFQGDDA--ILRMDKAEMLEAALVFMRKQVVKQQAPVSPLP 85
            |||||::||||:|:.|..||.||....|.:.  ..:::||::||..:.|:::|.....:..:|.|
Mouse    18 KPLLEKRRRARINESLSQLKGLVLPLLGAETSRSSKLEKADILEMTVRFLQEQPATLYSSAAPGP 82

  Fly    86 MDSFKNGYMNAVSEISRVMACTPAMSVDVGKTVMTHLGVEFQRMLQADQVQTSVTTSTPRPLSPA 150
            ::|:..||...::.::||:.....:...|...::.||.   ||.:..|      :.|...|.:||
Mouse    83 LNSYLEGYRACLARLARVLPACSVLEPAVSARLLEHLR---QRTVSDD------SPSLTLPPAPA 138

  Fly   151 SSGYHSDNEDSQSAASPKPVEETMWRPW 178
                     .:.|...|.|....:||||
Mouse   139 ---------PAPSPPVPPPGSSGLWRPW 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m5-HLHNP_524511.1 HLH 20..72 CDD:238036 21/50 (42%)
ORANGE 87..131 CDD:128787 10/43 (23%)
Hes2NP_001288734.1 bHLH_SF 10..73 CDD:381792 22/54 (41%)
ORANGE 85..123 CDD:128787 9/40 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..157 10/47 (21%)
WRPW motif 154..157 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830889
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I5264
Isobase 1 0.950 - 0 Normalized mean entropy S5317
OMA 1 1.010 - - QHG47782
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.