Sequence 1: | NP_524511.1 | Gene: | E(spl)m5-HLH / 43158 | FlyBaseID: | FBgn0002631 | Length: | 178 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_032261.1 | Gene: | Hes1 / 15205 | MGIID: | 104853 | Length: | 282 | Species: | Mus musculus |
Alignment Length: | 263 | Identity: | 55/263 - (20%) |
---|---|---|---|
Similarity: | 98/263 - (37%) | Gaps: | 87/263 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 PQSNNSTTFVSKT-QHYLKVKKPLLERQRRARMNKCLDTLKTLVAEFQGDDAI--LRMDKAEMLE 64
Fly 65 AALVFMRK-QVVKQQAPVS--PLPMDSFKNGYMNAVSEISRVMACTPAMSVDVGKTVMTHLG--- 123
Fly 124 VEFQRMLQADQVQTSVTTSTPRPLS---------------------------------------- 148
Fly 149 ------------PASSG--------------------YHSDNEDS--QSAASPKP----VEETMW 175
Fly 176 RPW 178 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
E(spl)m5-HLH | NP_524511.1 | HLH | 20..72 | CDD:238036 | 19/53 (36%) |
ORANGE | 87..131 | CDD:128787 | 7/46 (15%) | ||
Hes1 | NP_032261.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..44 | 9/25 (36%) | |
HLH | 32..95 | CDD:238036 | 21/62 (34%) | ||
Hairy_orange | 110..148 | CDD:284859 | 6/37 (16%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 158..204 | 4/45 (9%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 256..282 | 9/25 (36%) | |||
WRPW motif | 277..280 | 2/2 (100%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167830873 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4304 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000785 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR10985 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
6 | 5.840 |