DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m5-HLH and Bhlhe41

DIOPT Version :9

Sequence 1:NP_524511.1 Gene:E(spl)m5-HLH / 43158 FlyBaseID:FBgn0002631 Length:178 Species:Drosophila melanogaster
Sequence 2:XP_038964817.1 Gene:Bhlhe41 / 117095 RGDID:70900 Length:410 Species:Rattus norvegicus


Alignment Length:222 Identity:48/222 - (21%)
Similarity:87/222 - (39%) Gaps:63/222 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 STTFVSKTQHYLK-------VKKP--LLERQRRARMNKCLDTLKTLVAEFQGDDAILRMDKAEML 63
            |:.::.|.:..||       .|.|  |:|::||.|:|:|:..||.|:.|......:..::||.:|
  Rat    25 SSLYMCKPKRSLKRDDTKDTYKLPHRLIEKKRRDRINECIAQLKDLLPEHLKLTTLGHLEKAVVL 89

  Fly    64 EAALVFMR----------KQVVKQQ-------APVSPLPMDSFKNGYMNAVSEI----SRVMACT 107
            |..|..::          ::::..|       :||. ..:|:|.:|:.....|:    :|..:.|
  Rat    90 ELTLKHLKALTALTEQQHQKIIALQNGERSLKSPVQ-ADLDAFHSGFQTCAKEVLQYLARFESWT 153

  Fly   108 P-----AMSVDVGKTVMTHL------------------------GVEFQRMLQ-ADQVQTSVTTS 142
            |     |..|.....|.|.|                        |.|  |:.: ...:|.:...:
  Rat   154 PREPRCAQLVSHLHAVATQLLTPQVTPGRGPGRAPCSAGAAAASGSE--RVARCVPVIQRTQPGT 216

  Fly   143 TPRPLSPASSGYHSDNEDSQSAASPKP 169
            .|...:...|||..:.|..::|...:|
  Rat   217 EPEHDTDTDSGYGGEAEQGRAAVKQEP 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m5-HLHNP_524511.1 HLH 20..72 CDD:238036 19/70 (27%)
ORANGE 87..131 CDD:128787 15/76 (20%)
Bhlhe41XP_038964817.1 bHLH-O_DEC2 31..122 CDD:381593 22/90 (24%)
ORANGE 129..175 CDD:128787 12/45 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334565
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.