DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m5-HLH and her15.1

DIOPT Version :9

Sequence 1:NP_524511.1 Gene:E(spl)m5-HLH / 43158 FlyBaseID:FBgn0002631 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001353719.1 Gene:her15.1 / 100534909 ZFINID:ZDB-GENE-030707-2 Length:149 Species:Danio rerio


Alignment Length:183 Identity:49/183 - (26%)
Similarity:86/183 - (46%) Gaps:39/183 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAPQSNNSTTFVS-KTQHYLKVKKPLLERQRRARMNKCLDTLKTLV-AEFQGDDAILRMDKAEML 63
            |||......:.:| |.:|  |::||::|:.||.|:|.|::.||::: .|||..|...:::||::|
Zfish     1 MAPAYMTEYSKLSNKEKH--KLRKPVVEKMRRDRINNCIEQLKSMLEKEFQQQDPNAKLEKADIL 63

  Fly    64 EAALVFMRKQVVKQQAPVSP--LPMDSFKNGYMNAVSEISRVMACTPAMSVDVG-KTVMTHLGVE 125
            |..:||:::|:    .|.:|  ..::.:...:...:|.:|            || :.|...|..|
Zfish    64 EMTVVFLKQQL----RPKTPQNAQIEGYSQCWRETISFLS------------VGSEAVAQRLQQE 112

  Fly   126 FQRMLQADQVQTSVTTSTPRPLSPASSGYHSDNEDSQSAASPKPVEETMWRPW 178
            .||....:...|          |.|....|:..:....|.:|      :||||
Zfish   113 AQRSAAPELTHT----------SEAPHQQHTHIKQEPRAHAP------LWRPW 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m5-HLHNP_524511.1 HLH 20..72 CDD:238036 21/52 (40%)
ORANGE 87..131 CDD:128787 9/44 (20%)
her15.1NP_001353719.1 HLH 19..72 CDD:306515 21/52 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573677
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1378299at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.