DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m5-HLH and hes6.1

DIOPT Version :9

Sequence 1:NP_524511.1 Gene:E(spl)m5-HLH / 43158 FlyBaseID:FBgn0002631 Length:178 Species:Drosophila melanogaster
Sequence 2:XP_017949954.1 Gene:hes6.1 / 100126814 XenbaseID:XB-GENE-1018104 Length:195 Species:Xenopus tropicalis


Alignment Length:186 Identity:48/186 - (25%)
Similarity:87/186 - (46%) Gaps:34/186 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 VKKPLLERQRRARMNKCLDTLKTLVA--EFQGDDAILRMDKAEMLEAALVFMRKQVVKQQAPVSP 83
            ::|||:|::||||:|:.|..|:.:::  |||.     :|:.||:||..:..:.:.:..:.|....
 Frog    16 MRKPLVEKRRRARINESLQDLRGILSDTEFQS-----KMENAEVLELTVKRVERILRNRTAEADR 75

  Fly    84 LPMDS---FKNGYMNAVSEISRVMACTPAMSVDVGKTVMTHLGVEFQRMLQA---DQVQTSVTTS 142
            |..::   |..||:..:.|:...::..|.:...:...::.|| :|...:.:.   |.|...:..|
 Frog    76 LQREASERFAAGYIQCMHEVHTFVSSCPGIDASLAAELLNHL-LESMPLSEGSLQDLVMDVLLDS 139

  Fly   143 TPRP-------LSPASSGYHSDNEDSQ-----------SAASP--KPVEETMWRPW 178
            |...       |..:|....||.|:|:           |..:|  :|...||||||
 Frog   140 TSSEEGCGLGVLGSSSEDSCSDMEESEGEKAGMGSVQDSGRTPEIQPPTPTMWRPW 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m5-HLHNP_524511.1 HLH 20..72 CDD:238036 19/52 (37%)
ORANGE 87..131 CDD:128787 8/46 (17%)
hes6.1XP_017949954.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.