DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m5-HLH and hes5.3

DIOPT Version :9

Sequence 1:NP_524511.1 Gene:E(spl)m5-HLH / 43158 FlyBaseID:FBgn0002631 Length:178 Species:Drosophila melanogaster
Sequence 2:XP_002933894.1 Gene:hes5.3 / 100101782 XenbaseID:XB-GENE-480450 Length:160 Species:Xenopus tropicalis


Alignment Length:188 Identity:49/188 - (26%)
Similarity:83/188 - (44%) Gaps:46/188 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NNSTTFVSK--------TQHYLKVKKPLLERQRRARMNKCLDTLKTLV-AEFQGDDAILRMDKAE 61
            |::|..:|:        |:...|::||::|:.||.|:|..::.|:.|: .|||......:.:||:
 Frog     4 NSATCLISREYPADKLTTKQKNKIRKPMVEKMRRDRINSSINQLQNLLEKEFQLLQPDSKPEKAD 68

  Fly    62 MLEAALVFMRKQVVKQQAPVSPLPMDSFKNGYMNAVSEISRVMACTPAMSVDVGKTVMTHLGVEF 126
            :||.|:.|:::|:. .|:..:......|..||.|.:.|                    |...:.|
 Frog    69 ILELAVKFLKQQIC-SQSKNNRKDYQDFSQGYSNCLHE--------------------TFAFLSF 112

  Fly   127 QRMLQADQVQT----SVTTSTPRPLSPASSGYHSDNEDSQSAASPKPVEET--MWRPW 178
            .|..:..|::.    ....|.||.:|.:||  |.        ..|.||..|  :||||
 Frog   113 HRTEEEMQLKLMNHFQCLDSQPRGISVSSS--HQ--------KGPGPVASTKILWRPW 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m5-HLHNP_524511.1 HLH 20..72 CDD:238036 19/52 (37%)
ORANGE 87..131 CDD:128787 8/43 (19%)
hes5.3XP_002933894.1 bHLH-O_HES5 26..84 CDD:381467 20/58 (34%)
Hairy_orange 93..135 CDD:383064 10/61 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 65 1.000 Inparanoid score I5183
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1378299at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.060

Return to query results.
Submit another query.