DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m5-HLH and hes2

DIOPT Version :9

Sequence 1:NP_524511.1 Gene:E(spl)m5-HLH / 43158 FlyBaseID:FBgn0002631 Length:178 Species:Drosophila melanogaster
Sequence 2:XP_002933889.1 Gene:hes2 / 100038090 XenbaseID:XB-GENE-486138 Length:191 Species:Xenopus tropicalis


Alignment Length:172 Identity:51/172 - (29%)
Similarity:84/172 - (48%) Gaps:23/172 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KVKKPLLERQRRARMNKCLDTLKTLVAEFQGDD--AILRMDKAEMLEAALVFMRKQVVKQQAPVS 82
            |..|||:|::||||:|:.|:.||||:....|.|  ...:::||::||..:.|:|      ..|..
 Frog    30 KTLKPLMEKRRRARINESLNQLKTLILPLIGKDNSRYSKLEKADILEMTVRFLR------DIPPV 88

  Fly    83 PL--PMDSFKNGYMNAVSEISRVMACTPAMSVDVGKTVMTHLGVEFQRM--LQADQVQTSVTTST 143
            |.  |.|.:|.||...|..:|.::..:..::.:....::.||    ||.  |..........:.:
 Frog    89 PAQNPADRYKEGYRACVERLSAILNKSHVLTGEASNRLLNHL----QRSPELCCSDCHHPPKSHS 149

  Fly   144 PR---PLSPASSGYHSD--NEDSQSAASPKP--VEETMWRPW 178
            ||   .:||.:|...|.  |:.|....:|.|  :..::||||
 Frog   150 PRIVLHVSPRTSQLESPLLNQPSSHRPAPCPPQLNSSIWRPW 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m5-HLHNP_524511.1 HLH 20..72 CDD:238036 22/53 (42%)
ORANGE 87..131 CDD:128787 10/45 (22%)
hes2XP_002933889.1 bHLH-O_HES2 25..89 CDD:381469 24/64 (38%)
Hairy_orange 97..133 CDD:369405 8/39 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG47782
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.