DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m4-BFM and E(spl)malpha-BFM

DIOPT Version :9

Sequence 1:NP_524510.1 Gene:E(spl)m4-BFM / 43157 FlyBaseID:FBgn0002629 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_524506.1 Gene:E(spl)malpha-BFM / 43153 FlyBaseID:FBgn0002732 Length:138 Species:Drosophila melanogaster


Alignment Length:161 Identity:64/161 - (39%)
Similarity:85/161 - (52%) Gaps:32/161 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MCQNKI---NTNNTMTIKSNKKLSYSVKKLLQKIFKQQQRVEEEQNLKNALKANSLESLESMENS 62
            |||..:   ||||.|      |.|||:|::|:.:||:||:.:::..       .|||||||::|.
  Fly     1 MCQQVVVVANTNNKM------KTSYSIKQVLKTLFKKQQKQQQKPQ-------GSLESLESVDNL 52

  Fly    63 RNADLESASICASLESCENEANERLSQSCE------IEDYDFEQLPTVPVHFVRTAHGTFFWTAV 121
            |||.:|.|...   |..||.|||:|:|...      :|:.:.|:...|||.|.||..||||||..
  Fly    53 RNAQVEEAYYA---EIDENAANEKLAQLAHSQEFEIVEEQEDEEDVYVPVRFARTTAGTFFWTTN 114

  Fly   122 SDLPADNDLVEPLYCSTSNAIAIPQDRWVQA 152
            ....|.   |||..|.:...    ||||.||
  Fly   115 LQPVAS---VEPAMCYSMQF----QDRWAQA 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m4-BFMNP_524510.1 ESM4 1..152 CDD:374249 62/159 (39%)
E(spl)malpha-BFMNP_524506.1 ESM4 1..138 CDD:292574 62/159 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448323
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12254
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.