DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m4-BFM and Ocho

DIOPT Version :9

Sequence 1:NP_524510.1 Gene:E(spl)m4-BFM / 43157 FlyBaseID:FBgn0002629 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_001246759.1 Gene:Ocho / 39621 FlyBaseID:FBgn0040296 Length:149 Species:Drosophila melanogaster


Alignment Length:164 Identity:53/164 - (32%)
Similarity:73/164 - (44%) Gaps:34/164 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NKINTNNTMTIKSNKKLSYSVKKLLQKIFKQQQRVEEEQNLKNALKANSLESLE------SMENS 62
            :|..|.||| .||....|..:|.||:.:..|...:::||..:::..|:..:..|      .|:|.
  Fly     5 SKQKTLNTM-YKSKVSPSRRLKNLLKPLLGQFFNMKKEQPKRSSYIASEEKEAEFEWLSNDMDNM 68

  Fly    63 RNADLESASI-----CASLESC----ENEANERLSQSCEIEDYDFEQLPTVPVHFVRTAHGTFFW 118
            .|..||...|     ||..::.    ||.:.|  ..:.:.|||      .|||||.||..|||||
  Fly    69 ANEHLEHRLIEEIRQCAKEDAVIVYNENGSGE--LHTIDQEDY------YVPVHFARTNAGTFFW 125

  Fly   119 TAVSDLPADNDLVEPLYCSTSNAIAIPQDRWVQA 152
            |:|..     ...|| |....|.:    |||.||
  Fly   126 TSVQP-----KACEP-YAIEWNFL----DRWAQA 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m4-BFMNP_524510.1 ESM4 1..152 CDD:374249 51/162 (31%)
OchoNP_001246759.1 ESM4 9..149 CDD:374249 50/158 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448324
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12254
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.