DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m3-HLH and AT3G56770

DIOPT Version :9

Sequence 1:NP_524509.2 Gene:E(spl)m3-HLH / 43156 FlyBaseID:FBgn0002609 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_191236.1 Gene:AT3G56770 / 824844 AraportID:AT3G56770 Length:230 Species:Arabidopsis thaliana


Alignment Length:123 Identity:31/123 - (25%)
Similarity:56/123 - (45%) Gaps:17/123 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ERKRRARINKCLDDLKDLMVECLQQEGEHVTRLEKADILELTVDHMRKLKQRGGLSLQGVVAGVG 84
            |||||||||..|:.|:.|: .|       .::.:|:.:|...|..:::|||:   :|:.....:.
plant    53 ERKRRARINSHLNKLRKLL-SC-------NSKTDKSTLLAKVVQRVKELKQQ---TLEITDETIP 106

  Fly    85 SPPTSTSTAHVESFRSGYVHAADQITQVLLQTQQTDEIGRKIMKFLSTRLIELQTQLL 142
            |.....|..::|....|      ...:::.:.....|...:::|.|...|..||.:.|
plant   107 SETDEISVLNIEDCSRG------DDRRIIFKVSFCCEDRPELLKDLMETLKSLQMETL 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m3-HLHNP_524509.2 HLH 11..70 CDD:238036 17/49 (35%)
ORANGE 96..136 CDD:128787 6/39 (15%)
AT3G56770NP_191236.1 HLH 47..96 CDD:238036 18/50 (36%)
ACT_UUR-ACR-like 132..198 CDD:153145 7/27 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 45 1.000 Domainoid score I4621
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.