DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m3-HLH and Bhlhe41

DIOPT Version :9

Sequence 1:NP_524509.2 Gene:E(spl)m3-HLH / 43156 FlyBaseID:FBgn0002609 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_077789.1 Gene:Bhlhe41 / 79362 MGIID:1930704 Length:410 Species:Mus musculus


Alignment Length:233 Identity:64/233 - (27%)
Similarity:99/233 - (42%) Gaps:48/233 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 TYQYRKVMKPLLERKRRARINKCLDDLKDLMVECLQQEGEHVTRLEKADILELTVDHMRKL---- 68
            ||   |:...|:|:|||.|||:|:..||||:.|.|:.  ..:..||||.:||||:.|::.|    
Mouse    44 TY---KLPHRLIEKKRRDRINECIAQLKDLLPEHLKL--TTLGHLEKAVVLELTLKHLKALTALT 103

  Fly    69 --KQRGGLSLQGVVAGVGSPPTSTSTAHVESFRSGYVHAADQITQVLLQTQQTDEIGRKIMKFLS 131
              :.:..::||.....:.||    ..|.:::|.||:...|.::.|.|.:.:.......:..:.:|
Mouse   104 EQQHQKIIALQNGERSLKSP----VQADLDAFHSGFQTCAKEVLQYLARFESWTPREPRCAQLVS 164

  Fly   132 TRLIELQTQLLQQQQQQQQHQQQQIPQSSGRLAFPLLGGYGPAAAAAA--------------ISY 182
             .|..:.||||          ..|:|...|       .|..|.:|.||              |..
Mouse   165 -HLHAVATQLL----------TPQVPSGRG-------SGRAPCSAGAAAASGPERVARCVPVIQR 211

  Fly   183 SSFLTSKDELIDVTS-VDGNALSETASVSSQESGASEP 219
            :...|..:...|..| ..|.|....|:|..:..|.|.|
Mouse   212 TQPGTEPEHDTDTDSGYGGEAEQGRAAVKQEPPGDSSP 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m3-HLHNP_524509.2 HLH 11..70 CDD:238036 26/64 (41%)
ORANGE 96..136 CDD:128787 8/39 (21%)
Bhlhe41NP_077789.1 bHLH-O_DEC2 31..122 CDD:381593 30/82 (37%)
ORANGE 129..175 CDD:128787 12/56 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 209..255 11/41 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 360..410
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830856
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.