DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m3-HLH and Hes5

DIOPT Version :9

Sequence 1:NP_524509.2 Gene:E(spl)m3-HLH / 43156 FlyBaseID:FBgn0002609 Length:224 Species:Drosophila melanogaster
Sequence 2:XP_038966759.1 Gene:Hes5 / 79225 RGDID:621340 Length:196 Species:Rattus norvegicus


Alignment Length:250 Identity:59/250 - (23%)
Similarity:92/250 - (36%) Gaps:85/250 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVMEMSKTYQYRKVMKPLLERKRRARINKCLDDLKDLMVECLQQEGEHV--TRLEKADILELTVD 63
            :.:||....:..::.||::|:.||.|||..::.|| |::|  |:...|.  ::||||||||:.|.
  Rat     6 VAVEMLSPKEKNRLRKPVVEKMRRDRINSSIEQLK-LLLE--QEFARHQPNSKLEKADILEMAVS 67

  Fly    64 HMRKLKQRGG-----LSLQGVVAGVGSP------PTSTSTA------HVESFRSGYVHAADQITQ 111
            :::..|...|     |...||.....:|      ||:.:.|      | :.:..||.....:..|
  Rat    68 YLKHSKGELGACARVLLPTGVAPTARAPLMPLGLPTAFAAAAGPKSLH-QDYSEGYSWCLQEAVQ 131

  Fly   112 VLLQTQQTDEIGRKIMKFLSTRLIELQTQLLQQQQQQQQHQQQQIPQSSGRLAFPLLGGYGPAAA 176
            .|.....:|                .|.:||...|:                         |.|.
  Rat   132 FLTLHAASD----------------TQMKLLYHFQR-------------------------PPAP 155

  Fly   177 AAAISYSSFLTSKDELIDVTSVDG-------NALSETASVSSQESGASEPVWRPW 224
            ||.:.             .|...|       ::....||||:....|. .:||||
  Rat   156 AAPVK-------------ETPTPGAAPQPARSSTKAAASVSTSRQSAC-GLWRPW 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m3-HLHNP_524509.2 HLH 11..70 CDD:238036 23/60 (38%)
ORANGE 96..136 CDD:128787 5/39 (13%)
Hes5XP_038966759.1 bHLH-O_HES5 18..74 CDD:381467 23/58 (40%)
ORANGE 116..158 CDD:128787 12/82 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334612
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1011
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.