DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m3-HLH and hes6.2

DIOPT Version :9

Sequence 1:NP_524509.2 Gene:E(spl)m3-HLH / 43156 FlyBaseID:FBgn0002609 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001072210.1 Gene:hes6.2 / 779656 XenbaseID:XB-GENE-479404 Length:189 Species:Xenopus tropicalis


Alignment Length:214 Identity:62/214 - (28%)
Similarity:96/214 - (44%) Gaps:43/214 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 RKVMKPLLERKRRARINKCLDDLKDLMVECLQQEGEHVTRLEKADILELTVDHMRKLKQRGGLSL 76
            ||:.|||:|||||.|||.||:.||:.:::....:   .::||||||||:||.|::.:::.     
 Frog    18 RKLRKPLIERKRRERINTCLEQLKETVIKAFHLD---QSKLEKADILEMTVRHLQNIQKS----- 74

  Fly    77 QGVVAGVGSPPTSTSTAHVESFRSGYVHAADQITQVLLQTQQTDEIGRKIMKFLSTRLIELQTQL 141
                ...|.|...:..|. :.|.:||:....::..:||.....|..       |..||:      
 Frog    75 ----KSTGEPSQGSVDAQ-QRFSTGYIQCMHELHSLLLTCDWMDPA-------LGARLL------ 121

  Fly   142 LQQQQQQQQHQQQQIPQSSGRLAFPLLGGYGPAAAAAAISYSSFLTSKDELIDVTSVDGNALSET 206
                    .|..:.:|:..||.||.:....|......:.|.|      |...:.|||..:  |:.
 Frog   122 --------NHLLKSLPRPEGRTAFLIQDYEGDTGRTMSPSLS------DCEAEQTSVPLH--SDV 170

  Fly   207 ASVSSQES-GASEPVWRPW 224
            |...:|.| ..|..:||||
 Frog   171 AQGKTQCSLLRSLQMWRPW 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m3-HLHNP_524509.2 HLH 11..70 CDD:238036 28/57 (49%)
ORANGE 96..136 CDD:128787 9/39 (23%)
hes6.2NP_001072210.1 bHLH_O_HES 25..75 CDD:381416 23/61 (38%)
Hairy_orange 91..129 CDD:369405 10/58 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 88 1.000 Inparanoid score I4979
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1483774at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.060

Return to query results.
Submit another query.