DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m3-HLH and hes2.2

DIOPT Version :9

Sequence 1:NP_524509.2 Gene:E(spl)m3-HLH / 43156 FlyBaseID:FBgn0002609 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001038818.1 Gene:hes2.2 / 751634 ZFINID:ZDB-GENE-060825-55 Length:172 Species:Danio rerio


Alignment Length:221 Identity:57/221 - (25%)
Similarity:86/221 - (38%) Gaps:61/221 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 QYRKVMKPLLERKRRARINKCLDDLKDLMVECLQQEGEHVTRLEKADILELTVDHMRKLKQRGGL 74
            :.||.:|||||:|||||||..||.||.|::....::....::||||||||:||..:..::     
Zfish     7 ELRKTLKPLLEKKRRARINDSLDRLKALILPLTGKDNCRYSKLEKADILEMTVRFLTDIQ----- 66

  Fly    75 SLQGVVAGVGSPPTSTSTAHVESFRSGYVHAADQITQVLLQTQQTDEIGRKIMKFLSTRLI---- 135
                         |:.|.....||..||.....:::..|.||....|...::..|:...::    
Zfish    67 -------------TTPSKDTAVSFTEGYTTCLQRVSARLPQTSLDAETRHRVNDFIQRSVMPKTP 118

  Fly   136 ELQTQLLQQQQQQQQHQQ--QQIPQSSGRLAFPLLGGYGPAAAAAAISYSSFLTSKDELIDVTSV 198
            ..|....|..:...|.||  |.:..||.|...|                ...:.|:.|.:.:.: 
Zfish   119 ACQNCCAQSSRMMSQIQQKLQNLKSSSSRSTNP----------------KQDILSRPEPVPLIT- 166

  Fly   199 DGNALSETASVSSQESGASEPVWRPW 224
                                .|||||
Zfish   167 --------------------EVWRPW 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m3-HLHNP_524509.2 HLH 11..70 CDD:238036 29/58 (50%)
ORANGE 96..136 CDD:128787 9/43 (21%)
hes2.2NP_001038818.1 HLH 6..67 CDD:238036 29/77 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573782
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.