DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m3-HLH and hes5.2

DIOPT Version :9

Sequence 1:NP_524509.2 Gene:E(spl)m3-HLH / 43156 FlyBaseID:FBgn0002609 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001037974.1 Gene:hes5.2 / 733755 XenbaseID:XB-GENE-876635 Length:158 Species:Xenopus tropicalis


Alignment Length:215 Identity:54/215 - (25%)
Similarity:89/215 - (41%) Gaps:79/215 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KVMKPLLERKRRARINKCLDDLKDLMVECLQQEGEHVTRLEKADILELTVDHMRKLKQRGGLSLQ 77
            |:.||::|:.||.|||..::.||.|:.....::..:| :||||||||:||.::|:      .:||
 Frog    20 KLRKPVVEKMRRDRINSSIEQLKGLLETVFHKQQPNV-KLEKADILEMTVTYLRQ------QTLQ 77

  Fly    78 GVVAGVGSPPTSTSTAHVESFRSGYVHAADQITQVLLQTQQTDEIGR---KIMKFLSTRLIELQT 139
                                .:|...|..|      :|....|...|   :::.|||.       
 Frog    78 --------------------IKSEIPHNND------IQMDYKDGYSRCFEEVIDFLSL------- 109

  Fly   140 QLLQQQQQQQQHQQQQIPQSSGRLAFPLLGGYGPAAAAAAISYSSFLTSKDELIDVTSVDGNALS 204
                       ||:|  |:::     .|:..:...|.|::||......|:              |
 Frog   110 -----------HQKQ--PETA-----KLISHFHSKATASSISSFPIRCSQ--------------S 142

  Fly   205 ETASVSSQESGASEPVWRPW 224
            :||:    .:|:|..:||||
 Frog   143 KTAN----GTGSSSSLWRPW 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m3-HLHNP_524509.2 HLH 11..70 CDD:238036 24/56 (43%)
ORANGE 96..136 CDD:128787 9/42 (21%)
hes5.2NP_001037974.1 bHLH-O_HES5 20..77 CDD:381467 24/63 (38%)
ORANGE 90..128 CDD:128787 10/62 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1011
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.