DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m3-HLH and Hes3

DIOPT Version :9

Sequence 1:NP_524509.2 Gene:E(spl)m3-HLH / 43156 FlyBaseID:FBgn0002609 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_073178.1 Gene:Hes3 / 64628 RGDID:621339 Length:175 Species:Rattus norvegicus


Alignment Length:219 Identity:62/219 - (28%)
Similarity:88/219 - (40%) Gaps:57/219 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LERKRRARINKCLDDLKDLMVECLQQEGEHVTR---LEKADILELTVDHMRKLKQRGGLSLQG-- 78
            :|:|||||||..|:.|:.|    |::...|..|   |||||||||:|.::|.|:.    ||||  
  Rat     1 MEKKRRARINLSLEQLRSL----LERHYSHQIRKRKLEKADILELSVKYVRSLQN----SLQGLW 57

  Fly    79 -VVAGVGSPPTSTSTAHVESFRSGYVHAADQITQVLLQTQQTDEIGRKIMKFLSTRLIELQTQLL 142
             |.:||..|         ..||.|...::.::      ....|:.|             |:..||
  Rat    58 LVPSGVDYP---------SGFRGGLPGSSQRL------RPGEDDSG-------------LRCPLL 94

  Fly   143 QQQQQQQQHQQQQIPQSSGRLA--FPLLGGYGPAAAAAAISYSSFLTSKDELIDVTSVDGNALSE 205
            .|::......... ||::..|:  .|.:...||.|..:....|.|......|...|.:       
  Rat    95 LQRRAGSTTDSAN-PQTASVLSPCLPAIWAPGPPAGGSQSPQSPFPPLGGLLESSTGI------- 151

  Fly   206 TASVSSQESGASEP-----VWRPW 224
            .|...:....|..|     |||||
  Rat   152 LAPPPASNCQAENPRPGFRVWRPW 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m3-HLHNP_524509.2 HLH 11..70 CDD:238036 26/53 (49%)
ORANGE 96..136 CDD:128787 5/39 (13%)
Hes3NP_073178.1 bHLH-O_HES3 1..55 CDD:381503 28/61 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..175 13/57 (23%)
WRPW motif 172..175 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334556
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.