DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m3-HLH and bhlhe41

DIOPT Version :9

Sequence 1:NP_524509.2 Gene:E(spl)m3-HLH / 43156 FlyBaseID:FBgn0002609 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001027504.1 Gene:bhlhe41 / 613096 XenbaseID:XB-GENE-994875 Length:427 Species:Xenopus tropicalis


Alignment Length:173 Identity:51/173 - (29%)
Similarity:85/173 - (49%) Gaps:20/173 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 EMSKTYQYRKVMKPLLERKRRARINKCLDDLKDLMVECLQQEGEHVTRLEKADILELTVDHMRKL 68
            |..:||   |:...|:|:|||.|||:|:..||||:.|.|:.  ..:..||||.:||||:.|::.|
 Frog    39 ESKETY---KLPHRLIEKKRRDRINECIAQLKDLLPEHLKL--TTLGHLEKAVVLELTLKHLKGL 98

  Fly    69 ------KQRGGLSLQGVVAGVGSPPTSTSTAHVESFRSGYVHAADQITQVLLQTQQTDEIGRKIM 127
                  :.:..::||.....:.||    ....:::|.||:...|.::.|.|.:.:......::..
 Frog    99 TSLTEQQHQKIMALQNGEHALKSP----IQTDLDAFHSGFQTCAKEVLQYLSRFESWTSRDQRCT 159

  Fly   128 KFLSTRLIELQTQLLQQQQQQQQHQQQQIPQSSGRLAFPLLGG 170
            :.|: .|..:.:|:|...|.    ..|.:|...|..|.|..||
 Frog   160 QLLN-HLHTVSSQILSSSQL----LLQSVPGGKGSSASPGRGG 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m3-HLHNP_524509.2 HLH 11..70 CDD:238036 26/64 (41%)
ORANGE 96..136 CDD:128787 8/39 (21%)
bhlhe41NP_001027504.1 bHLH-O_DEC2 30..121 CDD:381593 31/86 (36%)
ORANGE 128..168 CDD:128787 8/40 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.