DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m3-HLH and hey1

DIOPT Version :9

Sequence 1:NP_524509.2 Gene:E(spl)m3-HLH / 43156 FlyBaseID:FBgn0002609 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_997726.1 Gene:hey1 / 58008 ZFINID:ZDB-GENE-000607-70 Length:317 Species:Danio rerio


Alignment Length:266 Identity:65/266 - (24%)
Similarity:99/266 - (37%) Gaps:53/266 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 QYRKVMKPLLERKRRARINKCLDDLKDLMVECLQQEGEHVTRLEKADILELTVDHMRKLKQRGGL 74
            |.||..:.::|::||.|||..|.:|:.|:....:::|.  .:||||:||::||||::.|...||.
Zfish    47 QARKRRRGIIEKRRRDRINNSLSELRRLVPSAFEKQGS--AKLEKAEILQMTVDHLKMLHAAGGK 109

  Fly    75 ------SLQGVVAGVGSPPTSTSTAHVESFRSGY-------VHAADQITQVLLQTQQTDEIGRKI 126
                  :|.....|:|.......||...|...|.       :.....:.....|.:....:|...
Zfish   110 GYFDAHALAMDYRGLGFRECLAETARYLSIIEGLDNTDPLRIRLVSHLNSYASQREAHSGLGHLA 174

  Fly   127 M-KFLSTRLIELQTQLLQQQQQQQ-------------------QHQQQQIPQSSGRLAFPLL--- 168
            . ....|....|...||.||||||                   .......|.:..||:..::   
Zfish   175 WGSAFGTPPSHLAHHLLLQQQQQQGAPLARSTSSPPSSNSSSPSSSSPSAPSTEPRLSGTVISEA 239

  Fly   169 GGYGPAAAAAAISYSSFLT-------SKDELIDVTSVDG--NALSETASVSSQESGASEP----- 219
            |..||.....:.|....||       |...|..::|:..  ..||....:|....|.:.|     
Zfish   240 GQTGPLRVPPSTSLPPGLTPPTASKLSPPLLTSLSSLSAFPFPLSAFPLLSPSSLGPATPSSSLG 304

  Fly   220 -VWRPW 224
             .:|||
Zfish   305 KPYRPW 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m3-HLHNP_524509.2 HLH 11..70 CDD:238036 23/58 (40%)
ORANGE 96..136 CDD:128787 5/47 (11%)
hey1NP_997726.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..59 4/11 (36%)
HLH 49..106 CDD:238036 23/58 (40%)
ORANGE 119..165 CDD:128787 7/45 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 193..264 15/70 (21%)
YRPW motif 307..310 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573628
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.