DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m3-HLH and her8.2

DIOPT Version :9

Sequence 1:NP_524509.2 Gene:E(spl)m3-HLH / 43156 FlyBaseID:FBgn0002609 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001159638.1 Gene:her8.2 / 565269 ZFINID:ZDB-GENE-060815-4 Length:211 Species:Danio rerio


Alignment Length:247 Identity:63/247 - (25%)
Similarity:95/247 - (38%) Gaps:92/247 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 RKVMKPLLERKRRARINKCLDDLKDLMVECLQQEGEHVTRLEKADILELTVDHMRKLKQRGGLSL 76
            ||:.|||:|||||.|||.|||.|::.:|...:.:   .::||||||||:||.|::.::.      
Zfish    23 RKLRKPLIERKRRERINLCLDQLRETVVAVFKPD---QSKLEKADILEMTVKHLQNIQS------ 78

  Fly    77 QGVVAGVGSPPTSTSTAHVESFRSGYVHAADQITQVLLQTQQTDEIGRKIMKFLSTRLIELQTQL 141
                :.|..|..:|...  :.:.:||:....::..:|......|       |.|.:||:      
Zfish    79 ----SRVSDPVLNTGAR--QRYSTGYIQCMQEVHNLLHSCDWMD-------KTLGSRLL------ 124

  Fly   142 LQQQQQQQQHQQQQIPQSSGRLAFPLLGGYGPAAAAAAI-----SYSSFLTSKDELIDVTSVDGN 201
                    .|..:.:|.|:...  |.|    |..:..::     .||||           .||  
Zfish   125 --------NHLFKSLPLSAKDC--PRL----PKTSLTSVPSDHSEYSSF-----------HVD-- 162

  Fly   202 ALSETAS---VSSQESGASEP--------------------------VWRPW 224
               ||||   .||.......|                          :||||
Zfish   163 ---ETASPKPCSSSPFLCKRPNQSQNQHFTPIRMPHDVESSHLSVLQMWRPW 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m3-HLHNP_524509.2 HLH 11..70 CDD:238036 29/57 (51%)
ORANGE 96..136 CDD:128787 8/39 (21%)
her8.2NP_001159638.1 HLH 20..77 CDD:238036 29/56 (52%)
Hairy_orange 94..132 CDD:284859 9/58 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573646
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5073
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1483774at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.