DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m3-HLH and Heyl

DIOPT Version :9

Sequence 1:NP_524509.2 Gene:E(spl)m3-HLH / 43156 FlyBaseID:FBgn0002609 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_038933.2 Gene:Heyl / 56198 MGIID:1860511 Length:326 Species:Mus musculus


Alignment Length:230 Identity:55/230 - (23%)
Similarity:96/230 - (41%) Gaps:62/230 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 QYRKVMKPLLERKRRARINKCLDDLKDLMVECLQQEGEHVTRLEKADILELTVDHMRKLKQRGGL 74
            |.||..:.::|::||.|||..|.:|:.|:....:::|.  ::||||::|::||||::.|...||.
Mouse    42 QARKKRRGIIEKRRRDRINSSLSELRRLVPTAFEKQGS--SKLEKAEVLQMTVDHLKMLHASGGT 104

  Fly    75 SLQGVVAGVGSPPTSTSTAHVESFRS-GYVHAADQITQVL--LQ--TQQTDEIGRKIMKFLSTRL 134
            ..            ..:.|....||| |:.....::.:.|  |:  :...|.:..:::..|.:..
Mouse   105 GF------------FDARALAVDFRSIGFRECLTEVIRYLGVLEGPSSHADPVRIRLLSHLKSYA 157

  Fly   135 IELQTQLLQQQQQQQQHQQQQIPQSSGRLAFPLLGGYGPAAAAAAISYSSFLTS-------KDEL 192
            .|::..                |.::..||||:...             |||.|       ..:|
Mouse   158 AEMEPS----------------PTTTSALAFPVWPW-------------SFLHSCPGLPSLNSQL 193

  Fly   193 IDVTSVDGNALSETAS----VSSQESGASEPVWRP 223
            ..:..|.|..|...:|    :|:..|.   ||.||
Mouse   194 AILGRVPGPVLPSISSPPYPISALRSA---PVHRP 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m3-HLHNP_524509.2 HLH 11..70 CDD:238036 22/58 (38%)
ORANGE 96..136 CDD:128787 8/44 (18%)
HeylNP_038933.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..56 4/13 (31%)
Transcriptional repression and interaction with NCOR1 and SIN3A. /evidence=ECO:0000250 42..111 25/82 (30%)
HLH 44..100 CDD:238036 22/57 (39%)
ORANGE 115..162 CDD:128787 9/46 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 223..260 2/3 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 272..306
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830880
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.