DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m3-HLH and Hes6

DIOPT Version :9

Sequence 1:NP_524509.2 Gene:E(spl)m3-HLH / 43156 FlyBaseID:FBgn0002609 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_062352.1 Gene:Hes6 / 55927 MGIID:1859852 Length:224 Species:Mus musculus


Alignment Length:227 Identity:61/227 - (26%)
Similarity:93/227 - (40%) Gaps:42/227 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 RKVMKPLLERKRRARINKCLDDLKDLMVECLQQEGEHV-TRLEKADILELTVDHMRKLKQRGGLS 75
            ||..|||:|:|||||||:.|.:|:.|:.      |..| .:||.|::|||||..           
Mouse    26 RKARKPLVEKKRRARINESLQELRLLLA------GTEVQAKLENAEVLELTVRR----------- 73

  Fly    76 LQGVVAGVGSPPTSTSTAHVESFRSGYVHAADQITQVLLQTQQTDEIGRKIMKFLSTRLIELQTQ 140
            :||.:.|.............|.|.:||:....::...:...|..|          :|...||...
Mouse    74 VQGALRGRAREREQLQAEASERFAAGYIQCMHEVHTFVSTCQAID----------ATVSAELLNH 128

  Fly   141 LLQQQQQQQQHQQQQ--------IPQSSGRLAFPLLGGYGPAAAAAAISYSSFLTSKDELIDVTS 197
            ||:....::....|.        :|..|||.::| .||...:..::.......|.|..|.|....
Mouse   129 LLESMPLREGSSFQDLLGDSLAGLPGGSGRSSWP-PGGSPESPLSSPPGPGDDLCSDLEEIPEAE 192

  Fly   198 V-----DGNALSETASVSSQESGASEPVWRPW 224
            :     :|..|..|:..|...:..::.|||||
Mouse   193 LNRVPAEGPDLVSTSLGSLTAARRAQSVWRPW 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m3-HLHNP_524509.2 HLH 11..70 CDD:238036 26/58 (45%)
ORANGE 96..136 CDD:128787 7/39 (18%)
Hes6NP_062352.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31 2/4 (50%)
bHLH_SF 24..81 CDD:412148 28/71 (39%)
Hairy_orange 96..134 CDD:400076 10/47 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 146..209 14/63 (22%)
WRPW motif 221..224 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830823
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.700

Return to query results.
Submit another query.