DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m3-HLH and hes2.1

DIOPT Version :9

Sequence 1:NP_524509.2 Gene:E(spl)m3-HLH / 43156 FlyBaseID:FBgn0002609 Length:224 Species:Drosophila melanogaster
Sequence 2:XP_021333940.1 Gene:hes2.1 / 559147 ZFINID:ZDB-GENE-081104-104 Length:195 Species:Danio rerio


Alignment Length:229 Identity:55/229 - (24%)
Similarity:104/229 - (45%) Gaps:59/229 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VMEMSKTYQYRKVMKPLLERKRRARINKCLDDLKDLMVECLQQEGEHVTRLEKADILELTVDHMR 66
            |.:..:.::.||.:|||:|::||||||..|:.||.|::..:.::....::||||||||:||..:|
Zfish    20 VAQRKEAHELRKTLKPLMEKRRRARINDSLNHLKTLILPLVGKDASRYSKLEKADILEMTVRFLR 84

  Fly    67 KLKQRGGLSLQGVVAGVGSPPTSTSTAHVESFRSGYVHAADQITQVLLQTQQTDEIGRKIMKFLS 131
            .|                  |:|::....:|::.||.....:|:.:|.|:....|..:::.:|: 
Zfish    85 DL------------------PSSSAKGQTDSYKEGYKACLQRISTMLPQSNLETEAHQRVSEFI- 130

  Fly   132 TRLIELQTQLLQQQQQQQQHQQQQIPQSSGRLAFPLLGGYGPAAAAAAISYSSFLTSK--DELID 194
                                 ||.:..||             ::.....:.:|.:.|:  ..|:.
Zfish   131 ---------------------QQSMASSS-------------SSCQNCCAQNSKMISQMHQRLVS 161

  Fly   195 VTSVDG--NALSETASVSSQESG--ASEPVWRPW 224
            :.:.:.  |.:|...:.|..:..  |:|.:||||
Zfish   162 LRNNNSMENPISTVPAPSQPQPAPQAAEDMWRPW 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m3-HLHNP_524509.2 HLH 11..70 CDD:238036 28/58 (48%)
ORANGE 96..136 CDD:128787 8/39 (21%)
hes2.1XP_021333940.1 HLH 30..86 CDD:306515 27/55 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573781
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.