DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m3-HLH and her13

DIOPT Version :9

Sequence 1:NP_524509.2 Gene:E(spl)m3-HLH / 43156 FlyBaseID:FBgn0002609 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001017901.1 Gene:her13 / 550600 ZFINID:ZDB-GENE-050228-1 Length:224 Species:Danio rerio


Alignment Length:237 Identity:62/237 - (26%)
Similarity:95/237 - (40%) Gaps:61/237 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 RKVMKPLLERKRRARINKCLDDLKDLMVECLQQEGEHVTRLEKADILELTVDHMRKLKQRGGLSL 76
            ||..||::|:|||||||:.|.||:.|:.     ..:..|::|.|::|||||..:..:.|.     
Zfish    25 RKTRKPIVEKKRRARINESLQDLRTLLT-----NNDLQTKMENAEVLELTVKRVESILQS----- 79

  Fly    77 QGVVAGVGSPPTSTSTAHV-ESFRSGYVHAADQITQVLLQTQQTDEIGRKIMKFLST------RL 134
                   .|..|.|.|... |.|.:||:...                 .::..|:||      |:
Zfish    80 -------RSQETGTVTQEASERFAAGYIQCM-----------------HEVHTFVSTCPGIEARV 120

  Fly   135 -IELQTQLLQQQQQQQQHQQQQI------PQSSGRLAFPLLGGYGPAAAAAAISYSS-----FLT 187
             .||...||:.....:.|..:.|      |.|||.   ....|.........:|..|     ||:
Zfish   121 AAELLNHLLESMPLNENHLHEMIKDLISEPSSSGD---SWQSGEAQNPGRHCVSGMSSELPQFLS 182

  Fly   188 SK--DEL---IDVTSVDGNALSETASVSSQESGASEPVWRPW 224
            :.  |:|   :|.|..:..:.|...::.......|:.:||||
Zfish   183 NPFCDDLCSDLDETETEERSASAEDTLDFSMVTHSKFMWRPW 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m3-HLHNP_524509.2 HLH 11..70 CDD:238036 24/57 (42%)
ORANGE 96..136 CDD:128787 8/46 (17%)
her13NP_001017901.1 HLH 22..71 CDD:238036 23/50 (46%)
Hairy_orange 95..133 CDD:284859 11/54 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573610
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5073
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1483774at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.760

Return to query results.
Submit another query.