DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m3-HLH and hes1

DIOPT Version :9

Sequence 1:NP_524509.2 Gene:E(spl)m3-HLH / 43156 FlyBaseID:FBgn0002609 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001011194.1 Gene:hes1 / 496617 XenbaseID:XB-GENE-487995 Length:267 Species:Xenopus tropicalis


Alignment Length:255 Identity:71/255 - (27%)
Similarity:115/255 - (45%) Gaps:60/255 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 QYRKVMKPLLERKRRARINKCLDDLKDLMVECLQQEGEHVTRLEKADILELTVDHMRKLKQRGGL 74
            ::||..||::|::||||||:.|..||.|:::.|:::....::||||||||:||.|:|.|::    
 Frog    33 EHRKSSKPIMEKRRRARINESLGQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQR---- 93

  Fly    75 SLQGVVAGVGSPPTSTSTAHVESFRSGYVHAADQITQVLLQTQ--QTDEIGRKIMKFLSTRLIEL 137
             :|...|      .||..:.:..:|:|:....:::|:.|...:  .||         :.|||:..
 Frog    94 -VQMTAA------LSTDPSVLGKYRAGFSECMNEVTRFLSTCEGVNTD---------VRTRLLGH 142

  Fly   138 QTQLLQQQQQQQQHQQQQIPQSSG---RLAFPL--LGGYGPAAAAAAIS-------------YSS 184
            ....:.|........|.|||.::.   ....||  |.|..|.::.|.|:             |..
 Frog   143 LANCMNQINAMNYPTQPQIPAAAAPHPAYGQPLVQLQGAAPQSSPAPIACKMGGPPVEAAKVYGG 207

  Fly   185 F-------------LTS-----KDELIDV--TSVDGNALSETASVSSQESGASEPVWRPW 224
            |             :|:     ...:|.|  .|..|.||..:.|.|...|..::.|||||
 Frog   208 FQLVPAPDGQFAFLITNPAFPHNGSVIPVYTNSNVGTALPPSVSPSVMPSVTADSVWRPW 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m3-HLHNP_524509.2 HLH 11..70 CDD:238036 29/58 (50%)
ORANGE 96..136 CDD:128787 9/41 (22%)
hes1NP_001011194.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..45 5/11 (45%)
bHLH-O_HES1_4 33..95 CDD:381465 29/66 (44%)
Hairy_orange 110..148 CDD:369405 9/46 (20%)
WRPW motif. /evidence=ECO:0000255 264..267 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.