DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m3-HLH and E(spl)m8-HLH

DIOPT Version :9

Sequence 1:NP_524509.2 Gene:E(spl)m3-HLH / 43156 FlyBaseID:FBgn0002609 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_524513.1 Gene:E(spl)m8-HLH / 43161 FlyBaseID:FBgn0000591 Length:179 Species:Drosophila melanogaster


Alignment Length:228 Identity:68/228 - (29%)
Similarity:113/228 - (49%) Gaps:62/228 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SKTYQYRKVMKPLLERKRRARINKCLDDLKDLMVECLQQEGEHVTRLEKADILELTVDHMRKLKQ 70
            :||..|:||.||:|||:||||:|||||:||.|:.|....:|  :.|::||::||..|..||:.| 
  Fly     5 TKTQIYQKVKKPMLERQRRARMNKCLDNLKTLVAELRGDDG--ILRMDKAEMLESAVIFMRQQK- 66

  Fly    71 RGGLSLQGVVAGVGSPPTSTSTAHVESFRSGYVHAADQITQVLLQTQ-QTDEIGRKIMKFLSTRL 134
                :.:.|.....|.|       ::||::||::|.:::::|:..|. .:.::|:.:|    |.|
  Fly    67 ----TPKKVAQEEQSLP-------LDSFKNGYMNAVNEVSRVMASTPGMSVDLGKSVM----THL 116

  Fly   135 IELQTQLLQQQQQQQQHQQQQIPQSSGRLAFPLLGGYGPAAAAAAISYSSFLTSKDELIDVTSVD 199
            ..:...|      ||.|:.|                          |.:.|:.:.   :|.:|:|
  Fly   117 GRVYKNL------QQFHEAQ--------------------------SAADFIQNS---MDCSSMD 146

  Fly   200 GNALSETAS--VSSQESGA------SEPVWRPW 224
            ...||..:|  .|..:|.|      .:|:||||
  Fly   147 KAPLSPASSGYHSDCDSPAPSPQPMQQPLWRPW 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m3-HLHNP_524509.2 HLH 11..70 CDD:238036 30/58 (52%)
ORANGE 96..136 CDD:128787 11/40 (28%)
E(spl)m8-HLHNP_524513.1 HLH 10..67 CDD:238036 31/63 (49%)
ORANGE 81..125 CDD:128787 12/53 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469365
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5073
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.