DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m3-HLH and E(spl)m5-HLH

DIOPT Version :9

Sequence 1:NP_524509.2 Gene:E(spl)m3-HLH / 43156 FlyBaseID:FBgn0002609 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_524511.1 Gene:E(spl)m5-HLH / 43158 FlyBaseID:FBgn0002631 Length:178 Species:Drosophila melanogaster


Alignment Length:227 Identity:68/227 - (29%)
Similarity:104/227 - (45%) Gaps:67/227 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 MSKTYQYRKVMKPLLERKRRARINKCLDDLKDLMVECLQQEGEHVTRLEKADILELTVDHMRK-- 67
            :|||..|.||.||||||:||||:|||||.||.|:.|.  |..:.:.|::||::||..:..|||  
  Fly    12 VSKTQHYLKVKKPLLERQRRARMNKCLDTLKTLVAEF--QGDDAILRMDKAEMLEAALVFMRKQV 74

  Fly    68 LKQRGGLSLQGVVAGVGSPPTSTSTAHVESFRSGYVHAADQITQVLLQT-QQTDEIGRKIMKFLS 131
            :||:         |.|...|       ::||::||::|..:|::|:..| ..:.::|:.:|..|.
  Fly    75 VKQQ---------APVSPLP-------MDSFKNGYMNAVSEISRVMACTPAMSVDVGKTVMTHLG 123

  Fly   132 TRLIELQTQLLQQQQQQQQHQQQQIPQSSGRLAFPLLGGYGPAAAAAAISYSSFLTSKDELIDVT 196
               :|.|..|      |....|..:..|:.|...|...||                         
  Fly   124 ---VEFQRML------QADQVQTSVTTSTPRPLSPASSGY------------------------- 154

  Fly   197 SVDGNALSETASVSSQESGASEPV----WRPW 224
                    .:.:..||.:.:.:||    ||||
  Fly   155 --------HSDNEDSQSAASPKPVEETMWRPW 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m3-HLHNP_524509.2 HLH 11..70 CDD:238036 31/60 (52%)
ORANGE 96..136 CDD:128787 11/40 (28%)
E(spl)m5-HLHNP_524511.1 HLH 20..72 CDD:238036 28/53 (53%)
ORANGE 87..131 CDD:128787 14/52 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469360
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5073
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.