DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m3-HLH and her12

DIOPT Version :9

Sequence 1:NP_524509.2 Gene:E(spl)m3-HLH / 43156 FlyBaseID:FBgn0002609 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_991182.1 Gene:her12 / 402914 ZFINID:ZDB-GENE-040824-5 Length:155 Species:Danio rerio


Alignment Length:216 Identity:53/216 - (24%)
Similarity:83/216 - (38%) Gaps:87/216 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KVMKPLLERKRRARINKCLDDLKDLMVECLQQE---GEHVTRLEKADILELTVDHMR-KLKQRGG 73
            |:.||::|:.||.|||.|:|.||.|    |::|   .:..|:||||||||:||..:: ::||:..
Zfish    23 KLRKPIVEKMRRDRINTCIDQLKSL----LEKEFHSHDPSTKLEKADILEMTVSFLKQQIKQQQQ 83

  Fly    74 LSLQGVVAGVGSPPTSTSTAHVESFRSGYVHAADQITQVLLQTQQTDEIGRKIMKFLSTRLIELQ 138
            :..:                   .|..||.|.                 .|:.:.|||       
Zfish    84 IPQR-------------------DFNEGYSHC-----------------WRESVHFLS------- 105

  Fly   139 TQLLQQQQQQQQHQQQQIPQSSGRLAFPLLGGYGPAAAAAAISYSSFLTSKDELIDVTSVDGNAL 203
               |.....:.||.... |:::..:      |..||.|.:.::                      
Zfish   106 ---LHSNAGELQHLHSG-PKTNSTM------GSTPATACSKLN---------------------- 138

  Fly   204 SETASVSSQESGASEPVWRPW 224
              ||::  |...:...|||||
Zfish   139 --TAAL--QHPDSVRAVWRPW 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m3-HLHNP_524509.2 HLH 11..70 CDD:238036 27/60 (45%)
ORANGE 96..136 CDD:128787 8/39 (21%)
her12NP_991182.1 HLH 19..74 CDD:238036 27/54 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573671
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1011
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.