DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m3-HLH and HES5

DIOPT Version :9

Sequence 1:NP_524509.2 Gene:E(spl)m3-HLH / 43156 FlyBaseID:FBgn0002609 Length:224 Species:Drosophila melanogaster
Sequence 2:XP_005244808.1 Gene:HES5 / 388585 HGNCID:19764 Length:198 Species:Homo sapiens


Alignment Length:249 Identity:54/249 - (21%)
Similarity:88/249 - (35%) Gaps:81/249 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVMEMSKTYQYRKVMKPLLERKRRARINKCLDDLKDLMVECLQQEGEHV--TRLEKADILELTVD 63
            :.:|:....:..::.||::|:.||.|||..::.|| |::|  |:...|.  ::||||||||:.|.
Human     6 VAVELLSPKEKNRLRKPVVEKMRRDRINSSIEQLK-LLLE--QEFARHQPNSKLEKADILEMAVS 67

  Fly    64 HMRKLKQRGGLSLQGVVA---------GVGSPPTSTSTAHV---------ESFRSGYVHAADQIT 110
            :::..|.....:.:...:         ...|||.....|.|         :.:..||.....:..
Human    68 YLKHSKGERARAPRAPSSHRAPAPPRPAARSPPPRLPAAFVAAAGPKSLHQDYSEGYSWCLQEAV 132

  Fly   111 QVLLQTQQTDEIGRKIMKFLSTRLIELQTQLLQ--QQQQQQQHQQQQIPQSSGRLAFPLLGGYGP 173
            |.|.....:|                .|.:||.  |:.........:.|::.|....|.|.....
Human   133 QFLTLHAASD----------------TQMKLLYHFQRPPAAPAAPAKEPKAPGAAPPPALSAKAT 181

  Fly   174 AAAAAAISYSSFLTSKDELIDVTSVDGNALSETASVSSQESGASEP---VWRPW 224
            |||||                                     |.:|   :||||
Human   182 AAAAA-------------------------------------AHQPACGLWRPW 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m3-HLHNP_524509.2 HLH 11..70 CDD:238036 23/60 (38%)
ORANGE 96..136 CDD:128787 5/39 (13%)
HES5XP_005244808.1 HLH 14..71 CDD:238036 23/59 (39%)
Hairy_orange 118..153 CDD:295407 8/50 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140941
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1011
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.