DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m3-HLH and hes6

DIOPT Version :9

Sequence 1:NP_524509.2 Gene:E(spl)m3-HLH / 43156 FlyBaseID:FBgn0002609 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_919381.2 Gene:hes6 / 373116 ZFINID:ZDB-GENE-030828-5 Length:226 Species:Danio rerio


Alignment Length:236 Identity:56/236 - (23%)
Similarity:99/236 - (41%) Gaps:52/236 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 RKVMKPLLERKRRARINKCLDDLKDLMVECLQQEGEHVTRLEKADILELTVDHMRKLKQRGGLSL 76
            ||..|||:|:|||||||:.|.:|:.|:.:...|     .::|.|::||:||..           :
Zfish    20 RKTRKPLVEKKRRARINESLQELRLLLADPDAQ-----VKMENAEVLEMTVKR-----------V 68

  Fly    77 QGVVAGVGSPPTSTSTAHVESFRSGYVHAADQITQVLLQTQQTD-EIGRKIMKFLSTRLIELQTQ 140
            :.::........|.:....|.|.:||:....::...:......| .|...::..|      |:..
Zfish    69 ESILQNKAKEADSVNREANERFAAGYIQCMHEVHTFVSSCPGIDATIAADLLNHL------LECM 127

  Fly   141 LLQQQQQQQQHQQQQIPQSS------GRLAFPLLGGYGPAAA---AAAISYSSFLTSKDEL---I 193
            .|..:::.|......|..|:      |..|:..|...|.:.|   ::|:|.:...||.|::   :
Zfish   128 PLNDEERFQDILSDLISDSNNSGTWPGEAAYATLSPGGTSVANGGSSALSPAPSTTSSDDICSDL 192

  Fly   194 DVTSVDGNALSETASVSSQESGASEPV----------WRPW 224
            |.|..:.:.:       |.::|...||          ||||
Zfish   193 DDTDTEHSRI-------SVDAGDQAPVVPTLYTNKSIWRPW 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m3-HLHNP_524509.2 HLH 11..70 CDD:238036 23/57 (40%)
ORANGE 96..136 CDD:128787 7/40 (18%)
hes6NP_919381.2 HLH 18..75 CDD:238036 23/70 (33%)
Hairy_orange 90..128 CDD:284859 7/43 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573602
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5073
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1483774at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.760

Return to query results.
Submit another query.