DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m3-HLH and Hey

DIOPT Version :9

Sequence 1:NP_524509.2 Gene:E(spl)m3-HLH / 43156 FlyBaseID:FBgn0002609 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_523657.1 Gene:Hey / 35764 FlyBaseID:FBgn0027788 Length:425 Species:Drosophila melanogaster


Alignment Length:327 Identity:70/327 - (21%)
Similarity:114/327 - (34%) Gaps:122/327 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 RKVMKPLLERKRRARINKCLDDLKDLMVECLQQEGEHVTRLEKADILELTVDHMRKLK------- 69
            ||..:.::|:|||.|||..|.:||.|:....:::|.  .:||||:||:|||:|::.|:       
  Fly   101 RKKRRGVIEKKRRDRINSSLTELKRLVPSAYEKQGS--AKLEKAEILQLTVEHLKSLQSKTLDSL 163

  Fly    70 ---------------------------------------------------QRGGLSLQGVVAGV 83
                                                               |:..||.:...:..
  Fly   164 SYDPQRVAMDYHIIGFRECAAEVARYLVTIEGMDIQDPLRLRLMSHLQYFVQQRELSAKSCASPG 228

  Fly    84 GSPPTSTST----------------------AHVESFRSGYVHAADQITQVLLQTQQTDEIGRKI 126
            |..|.:.|:                      |:|.|:.:.....:.|..|:..:|..:...|..:
  Fly   229 GWSPAAPSSSGYQPNCAAAPYQSYAAPANPGAYVSSYPTLSASPSQQAQQLGGRTSVSRTSGSAV 293

  Fly   127 MKFL------STRLIELQTQLLQQQQQQQQHQQQQIPQSSGRLA--------------------- 164
            .:.|      |....:.|.|..|||||||||||||..|...|..                     
  Fly   294 TESLPSHDLHSDSSSQQQQQQQQQQQQQQQHQQQQHQQQQQRTQTTPQPTQQQHYTHDHSAVHSE 358

  Fly   165 ------FPLLGGYGPAAAAA-AISYSSFLTSKDELIDVTSVDGNALSETASVSSQESGASEPVWR 222
                  ..|.....|||..: ::|||:     .....|:.:.|...:.::.:.......::| :|
  Fly   359 QQVPTYIELTNSNRPAAIGSDSLSYSA-----APQYPVSGLPGQDYNNSSVLQYATPNGAKP-YR 417

  Fly   223 PW 224
            ||
  Fly   418 PW 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m3-HLHNP_524509.2 HLH 11..70 CDD:238036 25/115 (22%)
ORANGE 96..136 CDD:128787 7/45 (16%)
HeyNP_523657.1 HLH 100..156 CDD:238036 24/56 (43%)
ORANGE 172..218 CDD:128787 1/45 (2%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I4621
eggNOG 1 0.900 - - E1_KOG4304
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.