DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m3-HLH and heyl

DIOPT Version :9

Sequence 1:NP_524509.2 Gene:E(spl)m3-HLH / 43156 FlyBaseID:FBgn0002609 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_859425.1 Gene:heyl / 335134 ZFINID:ZDB-GENE-030131-7074 Length:310 Species:Danio rerio


Alignment Length:255 Identity:65/255 - (25%)
Similarity:108/255 - (42%) Gaps:60/255 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 RKVMKPLLERKRRARINKCLDDLKDLMVECLQQEGEHVTRLEKADILELTVDHMRKLKQRGGLSL 76
            ||..:.::|::||.|||..|.:|:.|:....:::|.  ::||||:||::||||::.|...||   
Zfish    44 RKKRRGIIEKRRRDRINHSLSELRRLVPSAFEKQGS--SKLEKAEILQMTVDHLKLLHAMGG--- 103

  Fly    77 QGVVAGVGSPPTSTSTAHVESFRS-GYVHAADQITQVLLQ---TQQTDEIGRKIMKFLSTRLIEL 137
            :|..         .:.|....:|: |:.....::.:.|..   .:.:|.||.:::..||....||
Zfish   104 KGYF---------DARALAVDYRTLGFRECVGEVVRYLSSLEGVESSDPIGARLVSHLSHCASEL 159

  Fly   138 QTQLLQQQ----------QQQQQHQQQQIPQSSGRLAFP--------------LLGGYGPAAAAA 178
            . .|||..          ....|.|....|.||  ..||              :||...||....
Zfish   160 D-PLLQSPAALPFPPWPWASFPQLQAASPPASS--TPFPPNARRDLTPHGTATILGYPSPALRMG 221

  Fly   179 AIS-----YSSFLTSKDELIDVT---------SVDGNALSETASVSSQESGASEPVWRPW 224
            ::|     .:..|||..:|..|.         |.:|..:..::| ||..|...:..:||:
Zfish   222 SLSTQGTILNPALTSVRQLPSVPGHLHRLQQHSPEGRTVPSSSS-SSSNSSPPQISFRPF 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m3-HLHNP_524509.2 HLH 11..70 CDD:238036 23/57 (40%)
ORANGE 96..136 CDD:128787 8/43 (19%)
heylNP_859425.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
HLH 44..101 CDD:238036 23/58 (40%)
ORANGE 115..159 CDD:128787 8/43 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 182..208 6/27 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 248..310 8/34 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573724
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.