DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m3-HLH and HES1

DIOPT Version :9

Sequence 1:NP_524509.2 Gene:E(spl)m3-HLH / 43156 FlyBaseID:FBgn0002609 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_005515.1 Gene:HES1 / 3280 HGNCID:5192 Length:280 Species:Homo sapiens


Alignment Length:266 Identity:70/266 - (26%)
Similarity:110/266 - (41%) Gaps:71/266 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 QYRKVMKPLLERKRRARINKCLDDLKDLMVECLQQEGEHVTRLEKADILELTVDHMRKLKQRGGL 74
            ::||..||::|::||||||:.|..||.|:::.|:::....::||||||||:||.|:|.| ||..:
Human    33 EHRKSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNL-QRAQM 96

  Fly    75 SLQGVVAGVGSPPTSTSTAHVESFRSGYVHAADQITQVLLQTQQTDEIGRKIMKFLSTRLIELQT 139
                      :...||..:.:..:|:|:....:::|:.|   ...:.:..::...|...|....|
Human    97 ----------TAALSTDPSVLGKYRAGFSECMNEVTRFL---STCEGVNTEVRTRLLGHLANCMT 148

  Fly   140 QLLQQQQQQQQHQQQQ-----------------------IPQSSGRLAFPLLGG----YGPAAAA 177
            |:.......|.|...|                       :|...|  |.|..||    .|..|..
Human   149 QINAMTYPGQPHPALQAPPPPPPGPGGPQHAPFAPPPPLVPIPGG--AAPPPGGAPCKLGSQAGE 211

  Fly   178 AAISYSSF------------------LTSKDELIDV------TSVDGNALSETASVSSQESGASE 218
            ||..:..|                  ......:|.|      |||..||:|.    ||..|..::
Human   212 AAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSGTSVGPNAVSP----SSGPSLTAD 272

  Fly   219 PVWRPW 224
            .:||||
Human   273 SMWRPW 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m3-HLHNP_524509.2 HLH 11..70 CDD:238036 29/58 (50%)
ORANGE 96..136 CDD:128787 6/39 (15%)
HES1NP_005515.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..44 4/10 (40%)
bHLH-O_HES1_4 33..95 CDD:381465 31/62 (50%)
Hairy_orange 110..148 CDD:400076 6/40 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 157..200 7/44 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 254..280 13/29 (45%)
WRPW motif 275..278 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140909
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.