DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m3-HLH and her8a

DIOPT Version :9

Sequence 1:NP_524509.2 Gene:E(spl)m3-HLH / 43156 FlyBaseID:FBgn0002609 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_955918.3 Gene:her8a / 323656 ZFINID:ZDB-GENE-030131-2376 Length:221 Species:Danio rerio


Alignment Length:231 Identity:69/231 - (29%)
Similarity:103/231 - (44%) Gaps:47/231 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 RKVMKPLLERKRRARINKCLDDLKDLMVEC--LQQEGEHVTRLEKADILELTVDHMRKLKQRGGL 74
            ||:.|||:|:|||.|||..|:.||.:||:.  |.|     ::|||||:||:||.||..|::..| 
Zfish    20 RKLRKPLIEKKRRERINSSLEQLKGIMVDAYNLDQ-----SKLEKADVLEITVQHMENLQRGHG- 78

  Fly    75 SLQGVVAGVGSPPTSTSTAHVESFRSGYVHAADQITQVLLQTQQTDE-IGRKIMKFLSTRLIELQ 138
              ||   |..||.|...:.  :.:.|||:....::..:||.....|: :|.:::..|...|..:.
Zfish    79 --QG---GSNSPGTGFESR--QRYSSGYIQCMHEVHNLLLSCPGMDKTLGARLLNHLLKSLPHIS 136

  Fly   139 TQLLQQQQQQQQHQQQQIP---QSSGRLA-FPLLGGYGPAAAAAAISYSSFLTSKDELIDVTS-- 197
            |:                |   .|:|..: .||.....|....:::...:.|.|.......|.  
Zfish   137 TE----------------PSGTSSAGTSSPLPLSPTQSPINLPSSLQPHALLLSPSPPSSPTHSL 185

  Fly   198 VDGNALSETASVSSQESGASEP---------VWRPW 224
            |.....|...|..|.:|.||.|         :||||
Zfish   186 VRPREQSSPPSSPSPQSPASLPPFFPGVDPSMWRPW 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m3-HLHNP_524509.2 HLH 11..70 CDD:238036 31/59 (53%)
ORANGE 96..136 CDD:128787 9/40 (23%)
her8aNP_955918.3 HLH 17..75 CDD:238036 31/59 (53%)
Hairy_orange 95..133 CDD:284859 8/37 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573645
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5073
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1483774at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.